CB250248

Overview
NameCB250248
Unique NameCB250248
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length588
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB250248 vs. ExPASy Swiss-Prot
Match: U424_DICDI (UPF0424 protein OS=Dictyostelium discoideum GN=DDB_G0277951 PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.207e-35
Identity = 76/174 (43.68%), Postives = 112/174 (64.37%), Query Frame = 1
Query:   19 VSALNEAVPGSVKSVFKAWEQRLNSSGEHLESNDGDPELLVYIPFTTDVKIKSISIVGGADGTSPSKMRVFINREGIDFSDAQDMQAIQEWDLVENLQGVLEYQTRYSKFQSVANITLHFPDNFGGDTTQIHYIGLKGEATQLKRDVVVTIVYELRPNPSDHKTKSESGGGLSH 540
            ++ LNE V GSV+ +FK+WE R +   +H   +  D EL++ IPF    +IKSI I+GG  G+SP+KM+ +IN   IDF +       QEW+L E+ +G + Y T+ +KF ++ ++TL+FP NFG  TT+I++I LKG  T  KR++V T VYE +P   DH  KS+   G+SH
Sbjct:   31 ITCLNEKVKGSVRHIFKSWEDRHDL--KHFVESCDDEELIINIPFGAVTQIKSIIIIGGDGGSSPNKMKAYINNSNIDFGNINSFACTQEWNLHEDFEGQIGYSTKPTKFNNINHLTLYFPSNFGSPTTKIYFIALKGVYTSAKREIVNT-VYESKPQLQDH--KSDIFNGVSH 199          
BLAST of CB250248 vs. ExPASy Swiss-Prot
Match: CA128_HUMAN (UPF0424 protein C1orf128 OS=Homo sapiens GN=C1orf128 PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 7.579e-30
Identity = 71/163 (43.56%), Postives = 104/163 (63.80%), Query Frame = 1
Query:   19 VSALNEAVPGSVKSVFKAWEQRLNSSGEHLESNDGDPELLVYIPFTTDVKIKSISIVGGADGTSPSKMRVFINREGIDFSDAQDMQAIQEWDLVENLQGVLEYQTRYSKFQSVANITLHFPDNFGGDTTQIHYIGLKGEATQLKRDVVVTIVYELRPNPSDHK 507
            +  LNE+  GS + VFK WE+R + S + +ES D D ELL  IPFT +VK+K I I+G  D + PS+MR++ N   + F D +  +  Q + L  +L G LEY T+ S+F +V ++++H   NFG DTT++ YIGL+GE T+L+R  V    YE   NP+DH+
Sbjct:   40 LQCLNESREGSGRGVFKPWEERTDRS-KFVES-DADEELLFNIPFTGNVKLKGIIIMGEDDDSHPSEMRLYKNIPQMSFDDTE-REPDQTFSLNRDLTGELEYATKISRFSNVYHLSIHISKNFGADTTKVFYIGLRGEWTELRRHEVTICNYEASANPADHR 199          
BLAST of CB250248 vs. ExPASy Swiss-Prot
Match: U424_DROPS (UPF0424 protein GA19395 OS=Drosophila pseudoobscura pseudoobscura GN=GA19395 PE=3 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.293e-29
Identity = 71/171 (41.52%), Postives = 103/171 (60.23%), Query Frame = 1
Query:   19 VSALNEAVPGSVKSVFKAWEQRLNSSGEHLESNDGDPELLVYIPFTTDVKIKSISIVGGADGTSPSKMRVFINREGIDFSDAQDMQAIQEWDLVENLQGVLEYQTRYSKFQSVANITLHFPDNFGGDTTQIHYIGLKGEATQLKRDVVVTIVYELRPNPSDHKTKSESGGG 531
            +  LNE   GS K+VFK +E R + S      +D D ELL  IPFT ++K+K I I G  D + P+K+++F NR  + F DA+ ++  QE++L  + +G +EY  +   F SV ++TL+FP NFG D T+I+YIGL+GE ++     V    YE R N +DHK K   G G
Sbjct:   40 LECLNEETEGSGKTVFKPYESRQDMS--KFVQSDADEELLFNIPFTGNIKLKGIIICGANDDSHPNKVKIFKNRPKMTFDDAK-VKVDQEFELTRDPRGEIEYSPKVVNFSSVHHLTLYFPSNFGDDKTRIYYIGLRGEFSEAHYHGVTICNYEARANAADHKDKVFDGVG 207          
BLAST of CB250248 vs. ExPASy Swiss-Prot
Match: CA128_MOUSE (UPF0424 protein C1orf128 homolog OS=Mus musculus GN=Trp26 PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.293e-29
Identity = 70/163 (42.94%), Postives = 104/163 (63.80%), Query Frame = 1
Query:   19 VSALNEAVPGSVKSVFKAWEQRLNSSGEHLESNDGDPELLVYIPFTTDVKIKSISIVGGADGTSPSKMRVFINREGIDFSDAQDMQAIQEWDLVENLQGVLEYQTRYSKFQSVANITLHFPDNFGGDTTQIHYIGLKGEATQLKRDVVVTIVYELRPNPSDHK 507
            +  LNE+  GS + VFK WE+R + S + +ES D D ELL  IPFT +VK+K + I+G  D + PS+MR++ N   + F D +  +  Q + L  ++ G LEY T+ S+F +V ++++H   NFG DTT+I YIGL+GE T+L+R  V    YE   NP+DH+
Sbjct:   40 LQCLNESREGSGRGVFKPWEERTDRS-KFVES-DADEELLFNIPFTGNVKLKGVIIMGEDDDSHPSEMRLYKNIPQMSFDDTE-REPEQTFSLNRDITGELEYATKISRFSNVYHLSIHISKNFGADTTKIFYIGLRGEWTELRRHEVTICNYEASANPADHR 199          
BLAST of CB250248 vs. ExPASy Swiss-Prot
Match: U424_DROME (UPF0424 protein CG6153 OS=Drosophila melanogaster GN=CG6153 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 3.761e-29
Identity = 73/171 (42.69%), Postives = 105/171 (61.40%), Query Frame = 1
Query:   19 VSALNEAVPGSVKSVFKAWEQRLNSSGEHLESNDGDPELLVYIPFTTDVKIKSISIVGGADGTSPSKMRVFINREGIDFSDAQDMQAIQEWDLVENLQGVLEYQTRYSKFQSVANITLHFPDNFGGDTTQIHYIGLKGEATQLKRDVVVTIVYELRPNPSDHKTKSESGGG 531
            V  LNE   G  KSVFK +E+R + S +++ES D D ELL  IPFT ++K+K I I G  D + P+ +++F NR  + F DA+  +  QE+ L  + +G +EY  +   F SV +++L+FP NFG D T+I+YIGL+GE T+     V    YE R N +DHK K+  G G
Sbjct:   40 VECLNEETDGQGKSVFKPYEKRQDLS-KYVES-DADEELLFNIPFTGNIKLKGIIISGANDDSHPNMVKIFKNRPRMTFDDAR-AKPDQEFQLTRDARGEIEYSPKVVTFSSVHHLSLYFPSNFGEDITRIYYIGLRGEFTEAHYHGVTICNYESRANAADHKEKAFDGVG 207          
BLAST of CB250248 vs. ExPASy Swiss-Prot
Match: CA128_XENLA (UPF0424 protein C1orf128 homolog OS=Xenopus laevis PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.438e-28
Identity = 68/163 (41.72%), Postives = 103/163 (63.19%), Query Frame = 1
Query:   19 VSALNEAVPGSVKSVFKAWEQRLNSSGEHLESNDGDPELLVYIPFTTDVKIKSISIVGGADGTSPSKMRVFINREGIDFSDAQDMQAIQEWDLVENLQGVLEYQTRYSKFQSVANITLHFPDNFGGDTTQIHYIGLKGEATQLKRDVVVTIVYELRPNPSDHK 507
            +  LNE+  GS +SVF+AWE+R N     +ES+D D ELL  IPFT +VK+K I ++G    T P+++R+F N   + F D    +A Q + L  ++ G LEY T+ ++F +V+++++H   NFG + T+I+YIGL+GE T+  R  V    YE   NP+DHK
Sbjct:   38 LQCLNESREGSGRSVFRAWEER-NDRTRFVESDD-DEELLFNIPFTGNVKLKGIVLIGEDSDTHPAELRLFKNVPHMSFDDT-GREADQTFSLNIDVNGNLEYPTKIARFSNVSHLSIHISKNFGAENTKIYYIGLRGEWTEAHRHEVTICNYEAAANPADHK 197          
BLAST of CB250248 vs. ExPASy Swiss-Prot
Match: YOJ9_CAEEL (UPF0424 protein ZK353.9 OS=Caenorhabditis elegans GN=ZK353.9 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 2.696e-27
Identity = 69/165 (41.82%), Postives = 104/165 (63.03%), Query Frame = 1
Query:   19 VSALNEAVPGSVKSVFKAWEQRLNSSGEHLESNDGDPELLVYIPFTTDVKIKSISIVGGADGTSPSKMRVFINREGIDFSDAQDMQAIQEWDLVENLQGVLEYQTRYSKFQSVANITLHFPDNFGGDTTQIHYIGLKGEATQLKRDVVVTIVYELRPNPSDHKTK 513
            V+ LNE+V G+ K VFK  E+R +   E++ES D D ELL  IPFT  V++  +SI+G  DG+ P+K+R+F +RE + F D   ++A QE DL ++ QG+++Y  + SKF ++ N+++    NFG D T+I+YIGL+GE     R  +    YE R    DHK +
Sbjct:   37 VTTLNESVDGAGKKVFKVMEKR-DDRLEYVES-DCDHELLFNIPFTGHVRLTGLSIIGDEDGSHPAKIRLFKDREAMSFDDCS-IEADQEIDLKQDPQGLVDYPLKASKFGNIHNLSILVDANFGEDETKIYYIGLRGEFQHEFRQRIAIATYESRAQLKDHKNE 198          
BLAST of CB250248 vs. ExPASy Swiss-Prot
Match: CA128_DANRE (UPF0424 protein C1orf128 homolog OS=Danio rerio GN=zgc:77241 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.932e-25
Identity = 65/166 (39.16%), Postives = 100/166 (60.24%), Query Frame = 1
Query:   19 VSALNEAVPGSVKSVFKAWEQRLNSSGEHLESNDGDPELLVYIPFTTDVKIKSISIVGGADGTSPSKMRVFINREGIDFSDAQDMQAIQEWDLVENLQGVLEYQTRYSKFQSVANITLHFPDNFGGDTTQIHYIGLKGEATQLKRDVVVTIVYELRPNPSDHKTKS 516
            +  LNE+  G  K VFK W+QR + + + +ES D D ELL  IPFT  VK+K I I G  D + P+++R+F N   + F D    +  Q + L  + +  LEY T+ ++F +V ++++H   NFG ++T+++YIGL+GE T+  R  V    YE   NP+DHK +S
Sbjct:   39 LQCLNESRDGDGKLVFKPWDQRTDRN-KFVES-DADEELLFNIPFTGSVKLKGIIISGEDDESHPAEIRLFKNIPQMSFDDTS-REPEQAFRLNRDPRAELEYPTKIARFSNVEHLSIHVSRNFGAESTRVYYIGLRGEYTEAHRHEVTICNYEAAANPADHKVES 201          
BLAST of CB250248 vs. ExPASy Swiss-Prot
Match: YN82_SCHPO (UPF0424 protein P35G2.02 OS=Schizosaccharomyces pombe GN=SPBP35G2.02 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.097e-20
Identity = 60/165 (36.36%), Postives = 89/165 (53.94%), Query Frame = 1
Query:   19 VSALNEAVPGSVKSVFKAWEQRLNSSGEHLESNDGDPELLVYIPFTTDVKIKSISIVGGADGTSPSKMRVFINREGIDFSDAQDMQAIQEWDLVENLQG--VLEYQTRYSKFQSVANITLHFPDNFGG-DTTQIHYIGLKGEATQLKRDVVVTIVYELRPNPSDH 504
            +  LNEAVP S K VFK W+ R + +   +  +D D +LL  +PF     +KSI +    + T+P    +F NR  +DF    D+QA + ++     +G  + E+  +   +Q++ N+ + F  + G  D TQI YIGL+G     K D VVTI YE  P PSDH
Sbjct:   33 IVTLNEAVPDSGKLVFKPWDLRYDDTD--IVESDADDQLLFQVPFAGAATLKSILVRIFPNETAPHSFSLFPNRTDLDFDTIGDVQATETFEFPLTFEGSHIFEFPVKTRLYQNLQNLNIFFTKSDGSDDPTQIAYIGLRGSFVPFKGDPVVTI-YEATPRPSDH 194          
The following BLAST results are available for this feature:
BLAST of CB250248 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
U424_DICDI1.207e-3543.68UPF0424 protein OS=Dictyostelium discoideum GN=DDB... [more]
CA128_HUMAN7.579e-3043.56UPF0424 protein C1orf128 OS=Homo sapiens GN=C1orf1... [more]
U424_DROPS1.293e-2941.52UPF0424 protein GA19395 OS=Drosophila pseudoobscur... [more]
CA128_MOUSE1.293e-2942.94UPF0424 protein C1orf128 homolog OS=Mus musculus G... [more]
U424_DROME3.761e-2942.69UPF0424 protein CG6153 OS=Drosophila melanogaster ... [more]
CA128_XENLA2.438e-2841.72UPF0424 protein C1orf128 homolog OS=Xenopus laevis... [more]
YOJ9_CAEEL2.696e-2741.82UPF0424 protein ZK353.9 OS=Caenorhabditis elegans ... [more]
CA128_DANRE1.932e-2539.16UPF0424 protein C1orf128 homolog OS=Danio rerio GN... [more]
YN82_SCHPO1.097e-2036.36UPF0424 protein P35G2.02 OS=Schizosaccharomyces po... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0011 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ011 similar to expressed Arabidopsis protein (acc # NP_565614)POLYA: no, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250248 ID=CB250248|Name=CB250248|organism=Citrus sinensis|type=EST|length=588bp
ACTGGATGGCCTTTCTAGGTGTCTGCATTAAATGAGGCTGTTCCAGGGAG
TGTCAAGTCAGTTTTCAAAGCATGGGAGCAGCGTCTGAATTCTTCTGGGG
AACATTTGGAAAGCAATGATGGTGATCCAGAGTTACTTGTTTATATTCCA
TTTACTACAGATGTTAAGATCAAGAGCATTTCAATTGTTGGTGGTGCTGA
TGGAACAAGTCCTTCGAAGATGAGAGTGTTCATCAATCGAGAGGGTATTG
ACTTCTCAGATGCTCAAGATATGCAAGCTATTCAGGAATGGGATTTGGTT
GAGAATTTGCAAGGAGTGTTAGAATACCAAACAAGGTATTCCAAATTTCA
AAGTGTGGCCAATATCACATTACACTTCCCTGACAATTTTGGTGGTGACA
CAACTCAGATACACTACATTGGCCTAAAAGGGGAAGCCACCCAGTTGAAG
AGGGACGTCGTGGTAACAATTGTTTATGAGCTGAGGCCGAATCCCTCCGA
CCACAAAACAAAGTCTGAAAGCGGCGGTGGTCTTTCGCATGTGGAGTGAA
CAATTTCATGTTCTCTATCAAGGTTTATCACTTTAATG
back to top