CB250249

Overview
NameCB250249
Unique NameCB250249
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length656
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB250249 vs. ExPASy Swiss-Prot
Match: U7373_ARATH (UPF0737 protein AFP3 OS=Arabidopsis thaliana GN=AFP3 PE=1 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.958e-35
Identity = 73/105 (69.52%), Postives = 84/105 (80.00%), Query Frame = 2
Query:   29 ATSEKSGKSMAVKSQWNKPTVAKKGVKEAVRDVLEDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYPIL 343
            AT+ KS ++    +Q     + K    EA ++++EDMP VSTTGDGP+GK+I GFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNP P L
Sbjct:  131 ATTNKSVETSPSSAQSQPENLGK----EASQNIIEDMPFVSTTGDGPNGKKINGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPSPFL 231          
BLAST of CB250249 vs. ExPASy Swiss-Prot
Match: U7372_WHEAT (UPF0737 protein 2 OS=Triticum aestivum GN=AFP-B1 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.041e-28
Identity = 55/73 (75.34%), Postives = 67/73 (91.78%), Query Frame = 2
Query:  119 RDVLEDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYP 337
            + ++EDMP VS+  DGP+GK+I+GFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGGDV +PL+HIVVNP P
Sbjct:  240 KSMMEDMPMVSSKVDGPNGKKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNPAP 312          
BLAST of CB250249 vs. ExPASy Swiss-Prot
Match: U7371_WHEAT (UPF0737 protein 1 OS=Triticum aestivum GN=AFP-A1 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.041e-28
Identity = 55/73 (75.34%), Postives = 67/73 (91.78%), Query Frame = 2
Query:  119 RDVLEDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYP 337
            + ++EDMP VS+  DGP+GK+I+GFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGGDV +PL+HIVVNP P
Sbjct:  239 KSMMEDMPMVSSKVDGPNGKKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNPSP 311          
BLAST of CB250249 vs. ExPASy Swiss-Prot
Match: U7371_ORYSJ (UPF0737 protein Os03g0214200 OS=Oryza sativa subsp. japonica GN=Os03g0214200 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.041e-28
Identity = 58/80 (72.50%), Postives = 70/80 (87.50%), Query Frame = 2
Query:   98 KGVKEAVRDVLEDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYP 337
            K + +  R ++++MPCV T G  P+GKR+EGFLY+YRKGEEVRIVCVCHGSFL+PAEFVKHAGGGDVA+PL+HIVVNP P
Sbjct:  319 KSMGDVERIMMQEMPCVCTKGL-PNGKRVEGFLYKYRKGEEVRIVCVCHGSFLTPAEFVKHAGGGDVANPLRHIVVNPIP 397          
BLAST of CB250249 vs. ExPASy Swiss-Prot
Match: U7373_WHEAT (UPF0737 protein 3 OS=Triticum aestivum GN=AFP-D1 PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 5.165e-28
Identity = 54/73 (73.97%), Postives = 66/73 (90.41%), Query Frame = 2
Query:  119 RDVLEDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYP 337
            + ++EDMP VS+  DGP+ K+I+GFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGGDV +PL+HIVVNP P
Sbjct:  234 KSMMEDMPIVSSKVDGPNSKKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNPSP 306          
BLAST of CB250249 vs. ExPASy Swiss-Prot
Match: U7376_MAIZE (UPF0737 protein 6 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.348e-27
Identity = 53/71 (74.65%), Postives = 65/71 (91.55%), Query Frame = 2
Query:  125 VLEDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYP 337
            ++EDMP VS+  +GP+ +RI+GFLYRY+KGE+VRIVCVCHGSFL+PAEFVKHAGGGDV +PL+HIVVNP P
Sbjct:  216 MMEDMPMVSSKVEGPNARRIDGFLYRYKKGEDVRIVCVCHGSFLTPAEFVKHAGGGDVPNPLRHIVVNPAP 286          
BLAST of CB250249 vs. ExPASy Swiss-Prot
Match: U7372_ARATH (UPF0737 protein AFP2 OS=Arabidopsis thaliana GN=AFP2 PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.348e-27
Identity = 57/101 (56.44%), Postives = 73/101 (72.28%), Query Frame = 2
Query:   26 VATSEKSGKSMAVKSQWNKPTVAKKGVKEAVRDVLEDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVN 328
            V  + K  ++   K   ++ +V +KG   A    L DMPCV T GDGP+G+R++G LY+Y KGEEVRI+C+CHGSFL+PAEFVKH GGGDV  PL+HIVVN
Sbjct:  242 VTRANKVNENENEKRVRSEDSVDRKGKGMATSTGLVDMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVN 342          
BLAST of CB250249 vs. ExPASy Swiss-Prot
Match: U7372_ORYSJ (UPF0737 protein Os07g0602900 OS=Oryza sativa subsp. japonica GN=Os07g0602900 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 7.458e-27
Identity = 52/71 (73.24%), Postives = 65/71 (91.55%), Query Frame = 2
Query:  119 RDVLEDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNP 331
            + ++EDMP VS+  DGP+G++I+GFLY+YRK EEVRIVCVCHG+FL+PAEFVKHAGGGDV +PL+HIVVNP
Sbjct:  243 KSMMEDMPMVSSRVDGPNGRKIDGFLYKYRKREEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNP 313          
BLAST of CB250249 vs. ExPASy Swiss-Prot
Match: U7375_MAIZE (UPF0737 protein 5 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 3.133e-25
Identity = 50/67 (74.63%), Postives = 60/67 (89.55%), Query Frame = 2
Query:  131 EDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNP 331
            EDMP VS   +GP G++ +GFLY+YRKGEEVRIVCVCHGSFL+PAEFV+HAGGG+V +PL+HIVVNP
Sbjct:  235 EDMPMVSYKAEGPGGRKTDGFLYKYRKGEEVRIVCVCHGSFLTPAEFVEHAGGGEVPNPLRHIVVNP 301          
BLAST of CB250249 vs. ExPASy Swiss-Prot
Match: U7373_ORYSJ (UPF0737 protein Os03g0419100 OS=Oryza sativa subsp. japonica GN=Os03g0419100 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 3.133e-25
Identity = 49/71 (69.01%), Postives = 63/71 (88.73%), Query Frame = 2
Query:  125 VLEDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYP 337
            ++ DMP VS+  +GP+G++I+GFLY+YRKGE+V I+CVCHG F SPAEFVKHAGGGDV++PL+HIVVNP P
Sbjct:  233 IMMDMPMVSSKVEGPNGRKIDGFLYKYRKGEDVSIMCVCHGKFHSPAEFVKHAGGGDVSNPLRHIVVNPSP 303          
The following BLAST results are available for this feature:
BLAST of CB250249 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
U7373_ARATH1.958e-3569.52UPF0737 protein AFP3 OS=Arabidopsis thaliana GN=AF... [more]
U7372_WHEAT1.041e-2875.34UPF0737 protein 2 OS=Triticum aestivum GN=AFP-B1 P... [more]
U7371_WHEAT1.041e-2875.34UPF0737 protein 1 OS=Triticum aestivum GN=AFP-A1 P... [more]
U7371_ORYSJ1.041e-2872.50UPF0737 protein Os03g0214200 OS=Oryza sativa subsp... [more]
U7373_WHEAT5.165e-2873.97UPF0737 protein 3 OS=Triticum aestivum GN=AFP-D1 P... [more]
U7376_MAIZE3.348e-2774.65UPF0737 protein 6 OS=Zea mays PE=2 SV=1[more]
U7372_ARATH3.348e-2756.44UPF0737 protein AFP2 OS=Arabidopsis thaliana GN=AF... [more]
U7372_ORYSJ7.458e-2773.24UPF0737 protein Os07g0602900 OS=Oryza sativa subsp... [more]
U7375_MAIZE3.133e-2574.63UPF0737 protein 5 OS=Zea mays PE=2 SV=1[more]
U7373_ORYSJ3.133e-2569.01UPF0737 protein Os03g0419100 OS=Oryza sativa subsp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0012 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ013 similar to putative Arabidopsis protein (acc# NP_189598)POLYA: no, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250249 ID=CB250249|Name=CB250249|organism=Citrus sinensis|type=EST|length=656bp
AATGTAACCTCCAAGAAATACTGAGGTTGCAACATCTGAAAAATCAGGCA
AGTCCATGGCCGTGAAGAGTCAGTGGAACAAGCCAACAGTTGCTAAAAAA
GGAGTGAAGGAAGCAGTAAGAGATGTGCTGGAAGATATGCCTTGTGTGTC
TACAACAGGAGATGGCCCCGATGGAAAAAGAATTGAAGGTTTTCTTTACA
GATATAGGAAGGGTGAGGAAGTAAGGATCGTATGTGTTTGTCATGGGAGC
TTCCTCTCACCAGCCGAGTTTGTGAAGCATGCTGGTGGAGGCGATGTGGC
GCACCCACTAAAGCACATTGTTGTTAACCCTTATCCCATTTTGTAGAGCT
GCCATTAAGGGTTCATGATGCTTTAAAATCTCTTTATTTTACATCTTTTG
CGGGACGAGGCACTTGTATTGCGTTCAATACATGGAGCCTCCTGTTGGGA
AAAATAACAATTGTTACAGTGCACAAAATTGGTAAATCTACATAAGTAGT
TTTCTCCGCATCCAAGAAGATTAATTTCTTCAGCTTCTCGTCCATACTTA
TGGACCTCTTTTTCGAAATTCTAATCCGAAAAAGTCGGCAAAATGCAAGG
GTTCTGATTTGGAAGATAGCATTGCCATAGCCATCGGTTATTGCCGAAAT
GTTTTG
back to top