CB250261

Overview
NameCB250261
Unique NameCB250261
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length498
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig110 contig Csv1_Contig110:1..498. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250261 vs. ExPASy Swiss-Prot
Match: TSR1_PONAB (Pre-rRNA-processing protein TSR1 homolog OS=Pongo abelii GN=TSR1 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.075e-19
Identity = 45/70 (64.29%), Postives = 51/70 (72.86%), Query Frame = 3
Query:  282 FPDEVDTPLDVPARKRFAKYRGLKSFRTSSWDPKESLPPEYARIFAFDKFTRTQKHVFANALKMEQENMD 491
            FPDEVDTP DV AR RF KYRGLKSFRTS WDPKE+LP +YARIF F  FT T+K +F    + E E  +
Sbjct:  485 FPDEVDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTRKSIFKEVEEKEVEGAE 554          
BLAST of CB250261 vs. ExPASy Swiss-Prot
Match: TSR1_HUMAN (Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens GN=TSR1 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.075e-19
Identity = 45/70 (64.29%), Postives = 51/70 (72.86%), Query Frame = 3
Query:  282 FPDEVDTPLDVPARKRFAKYRGLKSFRTSSWDPKESLPPEYARIFAFDKFTRTQKHVFANALKMEQENMD 491
            FPDEVDTP DV AR RF KYRGLKSFRTS WDPKE+LP +YARIF F  FT T+K +F    + E E  +
Sbjct:  484 FPDEVDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTRKSIFKEVEEKEVEGAE 553          
BLAST of CB250261 vs. ExPASy Swiss-Prot
Match: TSR1_MOUSE (Pre-rRNA-processing protein TSR1 homolog OS=Mus musculus GN=Tsr1 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 9.104e-19
Identity = 43/70 (61.43%), Postives = 50/70 (71.43%), Query Frame = 3
Query:  282 FPDEVDTPLDVPARKRFAKYRGLKSFRTSSWDPKESLPPEYARIFAFDKFTRTQKHVFANALKMEQENMD 491
            FPDE+DTP DV AR RF KYRGLKSFRTS WDPKE+LP +YARIF F  F  T+K +F    + E E  +
Sbjct:  483 FPDEMDTPRDVAARIRFQKYRGLKSFRTSPWDPKENLPRDYARIFQFQNFVNTRKRIFKEIEEKEAEGAE 552          
BLAST of CB250261 vs. ExPASy Swiss-Prot
Match: TSR1_DROME (Pre-rRNA-processing protein TSR1 homolog OS=Drosophila melanogaster GN=CG7338 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.028e-18
Identity = 40/65 (61.54%), Postives = 51/65 (78.46%), Query Frame = 3
Query:  282 FPDEVDTPLDVPARKRFAKYRGLKSFRTSSWDPKESLPPEYARIFAFDKFTRTQKHVFANALKME 476
            +PDE+DTPLDVPAR+RF KYRGL+SFRTS WD KE+LP +YARI+ F  F RT++ +   A + E
Sbjct:  489 WPDEIDTPLDVPARERFQKYRGLESFRTSPWDAKENLPADYARIYQFQNFDRTKRRILNEAKEFE 553          
BLAST of CB250261 vs. ExPASy Swiss-Prot
Match: TSR1_CAEEL (Pre-rRNA-processing protein TSR1 homolog OS=Caenorhabditis elegans GN=tag-151 PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.242e-17
Identity = 39/59 (66.10%), Postives = 49/59 (83.05%), Query Frame = 3
Query:  282 FPDEVDTPLDVPARKRFAKYRGLKSFRTSSWDPKESLPPEYARIFAFDKFTRTQKHVFA 458
            +PDEVDTP+D+PAR  F KYRGLKSFRTS+WDPKE+LP +YARIF F  +  T+K+V +
Sbjct:  451 WPDEVDTPMDMPARIAFQKYRGLKSFRTSTWDPKENLPLDYARIFQFANYRNTKKNVMS 509          
BLAST of CB250261 vs. ExPASy Swiss-Prot
Match: TSR1_XENLA (Pre-rRNA-processing protein TSR1 homolog OS=Xenopus laevis GN=tsr1 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 4.995e-17
Identity = 45/71 (63.38%), Postives = 50/71 (70.42%), Query Frame = 3
Query:  282 FPDEVDTPLDVPARKRFAKYRGLKSFRTSSWDPKESLPPEYARIFAFDKFTRTQKHVFANALKMEQENMDD 494
            FPDEVDTP D  AR RF KYRGLKSFRTS WD KE+LP +YARIF F  F RT+K VF      E+E  D+
Sbjct:  496 FPDEVDTPRDQIARIRFQKYRGLKSFRTSPWDVKENLPRDYARIFQFHDFFRTRKRVF-----KEEEEKDE 561          
BLAST of CB250261 vs. ExPASy Swiss-Prot
Match: TSR1_CAEBR (Pre-rRNA-processing protein TSR1 homolog OS=Caenorhabditis briggsae GN=tag-151 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 6.524e-17
Identity = 39/59 (66.10%), Postives = 48/59 (81.36%), Query Frame = 3
Query:  282 FPDEVDTPLDVPARKRFAKYRGLKSFRTSSWDPKESLPPEYARIFAFDKFTRTQKHVFA 458
            +PDEVDTP+D PAR RF KYRGLKSFRTS+WD KE+LP +YARIF F  +  T+K+V +
Sbjct:  454 WPDEVDTPIDQPARIRFQKYRGLKSFRTSTWDAKENLPVDYARIFQFANYKNTKKNVMS 512          
BLAST of CB250261 vs. ExPASy Swiss-Prot
Match: TSR1_DICDI (Pre-rRNA-processing protein TSR1 homolog OS=Dictyostelium discoideum GN=tsr1 PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 3.958e-14
Identity = 41/108 (37.96%), Postives = 61/108 (56.48%), Query Frame = 3
Query:  123 NSDIDDDQASLNFRYADDGTENDSVMMEGEILTRXXXXXXXXXXXXXXXXXXXFPDEVDTPLDVPARKRFAKYRGLKSFRTSSWDPKESLPPEYARIFAFDKFTRTQK 446
            +SD +DD  +   +  D+  +    + + EIL                     +PDEVDTP +VP+R RF+K+RGLKSFR+S WD KE+LP +YA+IF F  F ++ +
Sbjct:  490 DSDDEDDDENKEEQSEDEDEDERKQLQQDEIL---------------------YPDEVDTPGNVPSRIRFSKFRGLKSFRSSPWDVKENLPIDYAKIFQFHSFNQSMR 576          
The following BLAST results are available for this feature:
BLAST of CB250261 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
TSR1_PONAB1.075e-1964.29Pre-rRNA-processing protein TSR1 homolog OS=Pongo ... [more]
TSR1_HUMAN1.075e-1964.29Pre-rRNA-processing protein TSR1 homolog OS=Homo s... [more]
TSR1_MOUSE9.104e-1961.43Pre-rRNA-processing protein TSR1 homolog OS=Mus mu... [more]
TSR1_DROME2.028e-1861.54Pre-rRNA-processing protein TSR1 homolog OS=Drosop... [more]
TSR1_CAEEL2.242e-1766.10Pre-rRNA-processing protein TSR1 homolog OS=Caenor... [more]
TSR1_XENLA4.995e-1763.38Pre-rRNA-processing protein TSR1 homolog OS=Xenopu... [more]
TSR1_CAEBR6.524e-1766.10Pre-rRNA-processing protein TSR1 homolog OS=Caenor... [more]
TSR1_DICDI3.958e-1437.96Pre-rRNA-processing protein TSR1 homolog OS=Dictyo... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0028 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ036 similar to imported Arabidopsis protein (acc# G96494), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250261 ID=CB250261|Name=CB250261|organism=Citrus sinensis|type=EST|length=498bp
ACCAGGCTGCTTGGATCGTGGATGATAGTGATGAGGCTGATTCAGATAGT
GATAATGATGCTGATGATGGTATGGTATTGGACCAAGAAGATAGAGGTTT
TCCTGGCTATGAGGGAACCAATAACTCAGACATTGATGATGATCAAGCTT
CCCTAAACTTCAGATATGCTGACGATGGAACTGAAAATGATTCTGTGATG
ATGGAAGGTGAAATCTTGACAAGAGAACAGATAGAGGATGAAATTAAAAA
AATTAAAGAGGCACATGCTGAAGATGAGGAATTTCCTGATGAAGTGGATA
CTCCGCTCGATGTTCCCGCCAGAAAACGCTTCGCGAAATATAGGGGCCTT
AAGTCCTTTAGGACCTCTTCATGGGACCCAAAAGAATCTTTACCTCCAGA
ATATGCTAGAATATTTGCATTTGATAAATTCACAAGAACACAGAAGCATG
TTTTTGCAAATGCCTTAAAAATGGAGCAAGAGAACATGGATGACAGTG
back to top