CB250272

Overview
NameCB250272
Unique NameCB250272
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length378
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12936 contig Csv1_Contig12936:746..1123. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250272 vs. ExPASy Swiss-Prot
Match: MDHP_ARATH (Malate dehydrogenase, chloroplastic OS=Arabidopsis thaliana GN=At3g47520 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.934e-14
Identity = 45/66 (68.18%), Postives = 48/66 (72.73%), Query Frame = -3
Query:    2 KRKTKFEESEREISILTPARAAARSRAGTEVVEAKAGAGSATLSMAYAAARFVESSLRALDGDGDV 199
            K K     ++ EI  LT         AGTEVV+AKAGAGSATLSMAYAAARFVESSLRALDGDGDV
Sbjct:  269 KTKPSVNFTDEEIQELT----VRIQNAGTEVVDAKAGAGSATLSMAYAAARFVESSLRALDGDGDV 330          
The following BLAST results are available for this feature:
BLAST of CB250272 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
MDHP_ARATH1.934e-1468.18Malate dehydrogenase, chloroplastic OS=Arabidopsis... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0044 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ055 similar to malate dehydrogenase (acc# T06325), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250272 ID=CB250272|Name=CB250272|organism=Citrus sinensis|type=EST|length=378bp
ACACGTCCCCATCTCCATCAAGAGCACGAAGTGAAGACTCGACAAATCTT
GCTGCTGCATATGCCATTGAGAGGGTAGCAGATCCTGCACCTGCCTTTGC
CTCCACAACTTCTGTACCTGCCCGGGATCGAGCGGCCGCCCGGGCAGGTG
TTAGAATTGAAATTTCTCTTTCACTTTCTTCAAATTTAGTTTTCCGCTTC
CTATTTTCCCCTTTTGGATAATTAACGACAATGAGTAAAAGCAACTTCAA
GATTGAGCATGAATTCGAGAAAAGGCGTGCTGAGGCGGAAAGAATTAGGG
AGAAATACCCAGATAGAATTCCGGTGATAGTGGAAAAGGCTGAGAGAAGT
GATATTCCTACAATGGACAAGAAAAAAT
back to top