CB250280

Overview
NameCB250280
Unique NameCB250280
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length634
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB250280 vs. ExPASy Swiss-Prot
Match: COMT3_POPKI (Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.087e-39
Identity = 84/149 (56.38%), Postives = 113/149 (75.84%), Query Frame = 2
Query:  194 DESFAYANQLVTGSVLPMTMHAAIELGVFKIIAKAGPGAKLSASEIAAQLPATKNKDAPMMLDRILRLLASHGVVECSLDDI-DGS-QRLYGQSNVSRYFVPNEDGVSLGPLMALIQDKVFLDSWSQLKEAIIEGGVPFDRVHGTHAFE 634
            DE   +A QL++ SVLPM +  AIEL + +I+AKAGPGA LS S+IA+ LP TKN DAP+MLDRILRLLAS+ ++ CSL D+ DG  +RLYG ++V ++   NEDGVS+ PL  + QDKV ++SW  LK+AI+EGG+PF++ +G  AFE
Sbjct:   16 DEEANFAMQLISSSVLPMVLKTAIELDLLEIMAKAGPGALLSPSDIASHLP-TKNPDAPVMLDRILRLLASYSILICSLRDLPDGKVERLYGLASVCKFLTKNEDGVSVSPLCLMNQDKVLMESWYHLKDAILEGGIPFNKAYGMTAFE 163          
BLAST of CB250280 vs. ExPASy Swiss-Prot
Match: COMT1_POPKI (Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.087e-39
Identity = 86/160 (53.75%), Postives = 114/160 (71.25%), Query Frame = 2
Query:  161 EIQQNMANEERDESFAYANQLVTGSVLPMTMHAAIELGVFKIIAKAGPGAKLSASEIAAQLPATKNKDAPMMLDRILRLLASHGVVECSLDDI-DGS-QRLYGQSNVSRYFVPNEDGVSLGPLMALIQDKVFLDSWSQLKEAIIEGGVPFDRVHGTHAFE 634
            E Q        +E+  +A QL + SVLPM +  AIEL + +I+AKAGPGA LS SEIA+ LP TKN DAP+MLDRILRLLAS+ ++ CSL D+ DG  +RLYG + V ++   NEDGVS+ PL  + QDKV ++SW  LK+AI+EGG+PF++ +G  AFE
Sbjct:    6 ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEIASHLP-TKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQDKVLMESWYYLKDAILEGGIPFNKAYGMTAFE 164          
BLAST of CB250280 vs. ExPASy Swiss-Prot
Match: COMT1_POPTM (Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 4.650e-39
Identity = 85/160 (53.12%), Postives = 114/160 (71.25%), Query Frame = 2
Query:  161 EIQQNMANEERDESFAYANQLVTGSVLPMTMHAAIELGVFKIIAKAGPGAKLSASEIAAQLPATKNKDAPMMLDRILRLLASHGVVECSLDDI-DGS-QRLYGQSNVSRYFVPNEDGVSLGPLMALIQDKVFLDSWSQLKEAIIEGGVPFDRVHGTHAFE 634
            E Q        +E+  +A QL + SVLPM +  AIEL + +I+AKAGPGA LS SEIA+ LP TKN DAP+MLDRILRLLAS+ ++ CSL D+ DG  +RLYG + V ++   NEDGVS+ PL  + QDKV ++SW  LK+AI++GG+PF++ +G  AFE
Sbjct:    6 ETQMTPTQVSDEEAHLFAMQLASASVLPMILKTAIELDLLEIMAKAGPGAFLSTSEIASHLP-TKNPDAPVMLDRILRLLASYSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQDKVLMESWYYLKDAILDGGIPFNKAYGMTAFE 164          
BLAST of CB250280 vs. ExPASy Swiss-Prot
Match: COMT2_POPTM (Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 5.141e-38
Identity = 82/149 (55.03%), Postives = 112/149 (75.17%), Query Frame = 2
Query:  194 DESFAYANQLVTGSVLPMTMHAAIELGVFKIIAKAGPGAKLSASEIAAQLPATKNKDAPMMLDRILRLLASHGVVECSLDDI-DGS-QRLYGQSNVSRYFVPNEDGVSLGPLMALIQDKVFLDSWSQLKEAIIEGGVPFDRVHGTHAFE 634
            DE   +A QL++ SVLPM +  AIEL + +I+AKAGPGA L  S+IA+ LP TKN +AP+MLDRILRLLAS+ ++ CSL D+ DG  +RLYG ++V ++   NEDGVS+ PL  + QDKV ++SW  LK+AI+EGG+PF++ +G  AFE
Sbjct:   16 DEEANFALQLISSSVLPMVLKTAIELDLLEIMAKAGPGALLPPSDIASHLP-TKNPNAPVMLDRILRLLASYSILICSLRDLPDGKVERLYGLASVCKFLTRNEDGVSVSPLCLMNQDKVLMESWYHLKDAILEGGIPFNKAYGMTAFE 163          
BLAST of CB250280 vs. ExPASy Swiss-Prot
Match: COMT1_EUCGU (Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.145e-37
Identity = 82/166 (49.40%), Postives = 116/166 (69.88%), Query Frame = 2
Query:  143 LSKTDKEIQQNMANEERDESFAYANQLVTGSVLPMTMHAAIELGVFKIIAKAGPGAKLSASEIAAQLPATKNKDAPMMLDRILRLLASHGVVECSLDDI-DGS-QRLYGQSNVSRYFVPNEDGVSLGPLMALIQDKVFLDSWSQLKEAIIEGGVPFDRVHGTHAFE 634
            +  T  E Q        +E+  +A QL + SVLPM + AAIEL + +I+AKAGPGA LS  E+AAQLP T+N +AP+MLDRI RLLAS+ V+ C+L ++ DG  +RLYG + V ++ V NEDGVS+  L  + QDK+ ++SW  LK+A++EGG+PF++ +G  AFE
Sbjct:    1 MGSTGSETQMTPTQVSDEEANLFAMQLASASVLPMVLKAAIELDLLEIMAKAGPGAFLSPGEVAAQLP-TQNPEAPVMLDRIFRLLASYSVLTCTLRNLPDGKVERLYGLAPVCKFLVKNEDGVSIAALNLMNQDKILMESWYYLKDAVLEGGIPFNKAYGMTAFE 165          
BLAST of CB250280 vs. ExPASy Swiss-Prot
Match: COMT1_CATRO (Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.954e-37
Identity = 78/157 (49.68%), Postives = 114/157 (72.61%), Query Frame = 2
Query:  170 QNMANEERDESFAYANQLVTGSVLPMTMHAAIELGVFKIIAKAGPGAKLSASEIAAQLPATKNKDAPMMLDRILRLLASHGVVECSLDDID--GSQRLYGQSNVSRYFVPNEDGVSLGPLMALIQDKVFLDSWSQLKEAIIEGGVPFDRVHGTHAFE 634
            +N   +E +E+   A +L + SVLPM + +AIEL + ++I K+GPGA +S SE+AAQLP T+N DAP+MLDRILRLLAS+ V+ C+L D+   G +RLY  + V ++   NEDGVS+  L+ + QDKV ++SW  LK+A++EGG+PF++ +G  AFE
Sbjct:    9 KNSMTKEEEEACLSAMRLASASVLPMVLKSAIELDLLELIKKSGPGAYVSPSELAAQLP-TQNPDAPVMLDRILRLLASYSVLNCTLKDLPDGGIERLYSLAPVCKFLTKNEDGVSMAALLLMNQDKVLMESWYHLKDAVLEGGIPFNKAYGMTAFE 164          
BLAST of CB250280 vs. ExPASy Swiss-Prot
Match: COMT1_EUCGL (Caffeic acid 3-O-methyltransferase (Fragment) OS=Eucalyptus globulus GN=COMT1 PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 5.685e-37
Identity = 78/144 (54.17%), Postives = 107/144 (74.31%), Query Frame = 2
Query:  209 YANQLVTGSVLPMTMHAAIELGVFKIIAKAGPGAKLSASEIAAQLPATKNKDAPMMLDRILRLLASHGVVECSLDDIDGS--QRLYGQSNVSRYFVPNEDGVSLGPLMALIQDKVFLDSWSQLKEAIIEGGVPFDRVHGTHAFE 634
            +A QL T SVLP  + AAIEL + +I+A+AGPGA L+  E+A+QLP T+N DAP+MLDRI RLLAS+ V+ C+L D+     +RLYG + + ++ V NEDGVSL PL  + QD+VFL+SW  +K+AI+EGG+PF + HG  AF+
Sbjct:    4 FAMQLATASVLPAVLTAAIELDLLEIMARAGPGAYLTPGEVASQLP-TQNPDAPVMLDRIFRLLASYSVLTCTLCDLPEGKVERLYGLAPLCKFLVKNEDGVSLAPLRLIDQDRVFLESWYYMKDAILEGGIPFHKAHGMTAFD 146          
BLAST of CB250280 vs. ExPASy Swiss-Prot
Match: COMT1_COFCA (Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 7.424e-37
Identity = 75/149 (50.34%), Postives = 112/149 (75.17%), Query Frame = 2
Query:  194 DESFAYANQLVTGSVLPMTMHAAIELGVFKIIAKAGPGAKLSASEIAAQLPATKNKDAPMMLDRILRLLASHGVVECSLDDI--DGSQRLYGQSNVSRYFVPNEDGVSLGPLMALIQDKVFLDSWSQLKEAIIEGGVPFDRVHGTHAFE 634
            +E+  +A  L + SVLPM + +AIEL + ++IAKAGPGA +S SE+AAQLP T N +AP+MLDRILRLLA++ V++C L+++   G +RLYG + V ++   N DGVS+ PL+ + QDKV ++SW  LK+A+++GG+PF++ +G  AFE
Sbjct:    4 EEACLFAMSLASASVLPMVLKSAIELDLLELIAKAGPGAYVSPSELAAQLP-THNPEAPIMLDRILRLLATYSVLDCKLNNLADGGVERLYGLAPVCKFLTKNADGVSMAPLLLMNQDKVLMESWYHLKDAVLDGGIPFNKAYGMTAFE 151          
BLAST of CB250280 vs. ExPASy Swiss-Prot
Match: COMT1_CLABR (Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 9.696e-37
Identity = 86/168 (51.19%), Postives = 117/168 (69.64%), Query Frame = 2
Query:  146 SKTDKEIQQNMANEERDESFAYANQLVTGSVLPMTMHAAIELGVFKIIAKA---GPGAKLSASEIAAQLPATKNKDAPMMLDRILRLLASHGVVECSLDDI-DGS-QRLYGQSNVSRYFVPNEDGVSLGPLMALIQDKVFLDSWSQLKEAIIEGGVPFDRVHGTHAFE 634
            S  + E Q    +   +E+  +A QL + SVLPM + AAIEL V +I+AK+   G GA +S +EIAAQLP T N DAP+MLDR+LRLLAS+ VV CSL ++ DG  +RLYG + V ++   NEDGVSL PL  + QDKV ++SW  LK+AI++GG+PF++ +G  AFE
Sbjct:    3 STGNAETQLTPTHVSDEEANLFAMQLASASVLPMVLKAAIELDVLEIMAKSIPHGSGAYISPAEIAAQLPTT-NPDAPVMLDRVLRLLASYSVVTCSLRELPDGKVERLYGLAPVCKFLTKNEDGVSLAPLCLMNQDKVLMESWYYLKDAILDGGIPFNKAYGMTAFE 169          
BLAST of CB250280 vs. ExPASy Swiss-Prot
Match: COMT1_CAPAN (Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2)

HSP 1 Score: 153.295 bits (386), Expect = 9.696e-37
Identity = 80/157 (50.96%), Postives = 115/157 (73.25%), Query Frame = 2
Query:  170 QNMANEERDESFAYANQLVTGSVLPMTMHAAIELGVFKIIAKAGPGAKLSASEIAAQLPATKNKDAPMMLDRILRLLASHGVVECSLDDI-DGS-QRLYGQSNVSRYFVPNEDGVSLGPLMALIQDKVFLDSWSQLKEAIIEGGVPFDRVHGTHAFE 634
            QN+   E DE+F +A QL + SVLPM + +A+EL + +I+AKAGPGA +S SE+AAQLP TKN +AP+MLDR+LRLLA++ V+ C+L  + DG  +RLY  + V +    N DGVS+ PL+ + QDKV ++SW  L +A+++GGVPF++ +G  AFE
Sbjct:    6 QNLTQTE-DEAFLFAMQLASASVLPMVLKSALELDLLEIMAKAGPGAAISPSELAAQLP-TKNPEAPVMLDRMLRLLATYSVLNCTLRTLPDGRVERLYSLAPVCKLLTKNADGVSVAPLLLMNQDKVLMESWYHLTDAVLDGGVPFNKAYGMTAFE 160          
The following BLAST results are available for this feature:
BLAST of CB250280 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
COMT3_POPKI2.087e-3956.38Caffeic acid 3-O-methyltransferase 3 OS=Populus ki... [more]
COMT1_POPKI2.087e-3953.75Caffeic acid 3-O-methyltransferase 1 OS=Populus ki... [more]
COMT1_POPTM4.650e-3953.13Caffeic acid 3-O-methyltransferase 1 OS=Populus tr... [more]
COMT2_POPTM5.141e-3855.03Caffeic acid 3-O-methyltransferase 2 OS=Populus tr... [more]
COMT1_EUCGU1.145e-3749.40Caffeic acid 3-O-methyltransferase OS=Eucalyptus g... [more]
COMT1_CATRO1.954e-3749.68Caffeic acid 3-O-methyltransferase OS=Catharanthus... [more]
COMT1_EUCGL5.685e-3754.17Caffeic acid 3-O-methyltransferase (Fragment) OS=E... [more]
COMT1_COFCA7.424e-3750.34Caffeic acid 3-O-methyltransferase OS=Coffea canep... [more]
COMT1_CLABR9.696e-3751.19Caffeic acid 3-O-methyltransferase OS=Clarkia brew... [more]
COMT1_CAPAN9.696e-3750.96Caffeic acid 3-O-methyltransferase OS=Capsicum ann... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0054 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ070 similar to caffeic acid O-methyltransferase (acc# AAF63200), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250280 ID=CB250280|Name=CB250280|organism=Citrus sinensis|type=EST|length=634bp
ACATTCAACAACTTTCACTTCAATATTTTCACAATAGCTAGAGGAAAGAA
AACGGAAACTAGCTCATATATACCAATATATAATAAGCTATATCCTTTTG
GACAGGCCAATCAATCTTCACACCACTATAATCGCATTGTTTCTTAGCAA
AACAGATAAGGAAATTCAACAAAATATGGCTAATGAAGAGAGAGACGAAA
GCTTTGCATATGCCAATCAATTGGTGACGGGTTCAGTGCTCCCCATGACC
ATGCATGCAGCAATTGAGCTGGGAGTTTTCAAGATCATAGCCAAAGCTGG
TCCTGGAGCAAAGCTCTCAGCTTCAGAGATTGCAGCTCAGTTGCCTGCCA
CCAAGAACAAAGACGCACCCATGATGTTGGACCGGATACTCAGGCTTCTG
GCTAGCCATGGTGTTGTTGAATGCTCACTAGATGATATTGATGGTTCTCA
GAGACTCTACGGTCAGAGTAATGTTTCCAGATACTTTGTGCCTAACGAAG
ATGGTGTCTCATTGGGCCCCTTAATGGCCTTAATTCAGGACAAGGTGTTT
CTGGACAGCTGGTCCCAATTAAAAGAAGCTATTATTGAAGGAGGAGTTCC
ATTTGATCGTGTTCATGGAACACACGCTTTTGAG
back to top