CB250284

Overview
NameCB250284
Unique NameCB250284
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length490
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2655 contig Csv1_Contig2655:782..1271. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250284 vs. ExPASy Swiss-Prot
Match: MTNA_DESHY (Methylthioribose-1-phosphate isomerase OS=Desulfitobacterium hafniense (strain Y51) GN=mtnA PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.491e-34
Identity = 79/130 (60.77%), Postives = 92/130 (70.77%), Query Frame = 2
Query:    2 HDRIPXXXXXXXXXXXLMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCSRGGLGEQVAASGISVWNPAFDVTPANLITGIITEKGVVT 391
            +D IP           LM+ G +  VIVGADR+AANGDTANKIGTYSLA+ A  H I FYVAAP ++IDL + SGQ+I IEER+ KEL   R   G QVA   + V+NPAFDVTPA LITGIITEKG+VT
Sbjct:  205 NDHIPVTLIADNMAGFLMQQGNIDLVIVGADRIAANGDTANKIGTYSLAVLAHAHGIPFYVAAPTSTIDLKVPSGQDIPIEERNPKEL---REVFGVQVAPPEVPVYNPAFDVTPAKLITGIITEKGIVT 331          
BLAST of CB250284 vs. ExPASy Swiss-Prot
Match: MTNA_DESHD (Methylthioribose-1-phosphate isomerase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=mtnA PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.491e-34
Identity = 79/130 (60.77%), Postives = 92/130 (70.77%), Query Frame = 2
Query:    2 HDRIPXXXXXXXXXXXLMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCSRGGLGEQVAASGISVWNPAFDVTPANLITGIITEKGVVT 391
            +D IP           LM+ G +  VIVGADR+AANGDTANKIGTYSLA+ A  H I FYVAAP ++IDL + SGQ+I IEER+ KEL   R   G QVA   + V+NPAFDVTPA LITGIITEKG+VT
Sbjct:  205 NDHIPVTLIADNMAGFLMQQGNIDLVIVGADRIAANGDTANKIGTYSLAVLAHAHGIPFYVAAPTSTIDLKVPSGQDIPIEERNPKEL---REVFGVQVAPPEVPVYNPAFDVTPAKLITGIITEKGIVT 331          
BLAST of CB250284 vs. ExPASy Swiss-Prot
Match: MTNA_XENLA (Methylthioribose-1-phosphate isomerase OS=Xenopus laevis GN=mri1 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.649e-33
Identity = 75/128 (58.59%), Postives = 91/128 (71.09%), Query Frame = 2
Query:    2 HDRIPXXXXXXXXXXXLMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCSRGGLGEQVAASGISVWNPAFDVTPANLITGIITEKGV 385
            +++IP            M++ +V+AV+VGADRV ANGDTANKIGTY LA+ AK+H I FYVAAP TS DL+L +G  IVIEER + EL       G ++AA GI VWNPAFDVTP  LITGIITE+GV
Sbjct:  216 YEKIPATLITDSMASVTMRERKVTAVVVGADRVVANGDTANKIGTYQLAIIAKYHGIPFYVAAPSTSCDLSLPTGGSIVIEERPSHELTDIN---GIRIAAPGIDVWNPAFDVTPHELITGIITERGV 340          
BLAST of CB250284 vs. ExPASy Swiss-Prot
Match: MTNA_XENTR (Methylthioribose-1-phosphate isomerase OS=Xenopus tropicalis GN=mri1 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 2.813e-33
Identity = 74/128 (57.81%), Postives = 91/128 (71.09%), Query Frame = 2
Query:    2 HDRIPXXXXXXXXXXXLMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCSRGGLGEQVAASGISVWNPAFDVTPANLITGIITEKGV 385
            +++IP            ++D +V+AV+VGADRV ANGDTANKIGTY LA+ A++H I FYVAAP TS DL+L +G  IVIEER + EL       G ++AA GI VWNPAFDVTP  LITGIITE+GV
Sbjct:  216 YEKIPATLITDSMASAAIRDRKVTAVVVGADRVVANGDTANKIGTYQLAITARYHGIPFYVAAPSTSCDLSLPTGGSIVIEERPSHELTDIN---GVRIAAPGIGVWNPAFDVTPHELITGIITERGV 340          
BLAST of CB250284 vs. ExPASy Swiss-Prot
Match: MTNA_SOLUE (Methylthioribose-1-phosphate isomerase OS=Solibacter usitatus (strain Ellin6076) GN=mtnA PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 4.062e-32
Identity = 72/127 (56.69%), Postives = 90/127 (70.87%), Query Frame = 2
Query:    5 DRIPXXXXXXXXXXXLMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCSRGGLGEQVAASGISVWNPAFDVTPANLITGIITEKGV 385
            D IP            MK GR+  V+VGADR+AANGD ANK+GTYS+A+ AK + + FYVAAP++++DLTLSSG++I IEERSA E+       G  VA +G +V NPAFDVTPA  +TGIITEKGV
Sbjct:  204 DSIPTTLITDNMAGHFMKAGRIGCVVVGADRIAANGDVANKVGTYSVAVLAKENGVPFYVAAPISTLDLTLSSGEQIPIEERSAAEV---THVFGHAVAPAGTAVKNPAFDVTPARYVTGIITEKGV 327          
BLAST of CB250284 vs. ExPASy Swiss-Prot
Match: MTNA_PELTS (Methylthioribose-1-phosphate isomerase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mtnA PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 9.048e-32
Identity = 68/113 (60.18%), Postives = 87/113 (76.99%), Query Frame = 2
Query:   50 LMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCSRGGLGEQVAASGISVWNPAFDVTPANLITGIITEKGVV 388
            L+  G+   V+VGADR+AANGD ANKIGTYSLA+ A+ H I FYVAAP+++IDL+L+SG+EI IEER + E+       G  VA  G++VWNPAFDVTPA LIT IIT++G+V
Sbjct:  223 LLAKGKADLVVVGADRIAANGDVANKIGTYSLAVLAREHKIPFYVAAPVSTIDLSLASGEEIPIEERDSSEVTHL---AGRPVAPEGVNVWNPAFDVTPARLITAIITDRGIV 332          
BLAST of CB250284 vs. ExPASy Swiss-Prot
Match: MTNA_RHOBA (Methylthioribose-1-phosphate isomerase OS=Rhodopirellula baltica GN=mtnA PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 2.633e-31
Identity = 69/115 (60.00%), Postives = 84/115 (73.04%), Query Frame = 2
Query:   50 LMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCSRGGLGEQVAASGISVWNPAFDVTPANLITGIITEKGVVTK 394
            LM+ GRV AVIVGADR+AANGD ANKIGTY LA+ AK+HNI FYVAAP  + D  L SG  I IE+RSA E+    G    +    G++V NPAFDVTPA L+T +ITEKGV+++
Sbjct:  230 LMRQGRVDAVIVGADRIAANGDVANKIGTYPLAVLAKYHNIPFYVAAPTNTFDSELESGDLIPIEQRSADEVSYPCGTDSPRQTPEGVAVVNPAFDVTPAELVTALITEKGVISE 344          
BLAST of CB250284 vs. ExPASy Swiss-Prot
Match: MTNA_GEOMG (Methylthioribose-1-phosphate isomerase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=mtnA PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 4.491e-31
Identity = 72/129 (55.81%), Postives = 90/129 (69.77%), Query Frame = 2
Query:    5 DRIPXXXXXXXXXXXLMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCSRGGLGEQVAASGISVWNPAFDVTPANLITGIITEKGVVT 391
            D IP            MK G ++  +VGADR+AANGDTANKIGTYS+A+ AK +NI FYVAAP +++DL+L +G +I IEER A+E+   +   G  VA  GI+V NPAFDVTPA  I GIITEKGV+T
Sbjct:  208 DGIPVTLISDNMAGFFMKRGEITCCVVGADRIAANGDTANKIGTYSVAVLAKENNIPFYVAAPTSTLDLSLENGDQIPIEERHAREVTHLQ---GLPVAPEGIAVRNPAFDVTPARYIAGIITEKGVIT 333          
BLAST of CB250284 vs. ExPASy Swiss-Prot
Match: MTNA_FERNB (Methylthioribose-1-phosphate isomerase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=mtnA PE=3 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 4.491e-31
Identity = 69/114 (60.53%), Postives = 91/114 (79.82%), Query Frame = 2
Query:   50 LMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEERSAKELL-CSRGGLGEQVAASGISVWNPAFDVTPANLITGIITEKGVV 388
            +MK G+++AVIVGADR+AANGD ANKIGTY +A+ A  H I FYVAAPL++ID+++ SG+EI IEERS +E+L C     G++VA + ++V+NPAFDVT   L+T IITEKGVV
Sbjct:  225 VMKQGKINAVIVGADRIAANGDVANKIGTYMVAVLANRHGIPFYVAAPLSTIDMSIKSGKEIPIEERSHEEVLTCG----GKRVAPNNVNVYNPAFDVTDHELVTAIITEKGVV 334          
BLAST of CB250284 vs. ExPASy Swiss-Prot
Match: MTNA_RAT (Methylthioribose-1-phosphate isomerase OS=Rattus norvegicus GN=Mri1 PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 5.865e-31
Identity = 76/129 (58.91%), Postives = 88/129 (68.22%), Query Frame = 2
Query:    2 HDRIPXXXXXXXXXXXLMKDGRVSAVIVGADRVAANGDTANKIGTYSLALCAKFHNILFYVAAPLTSIDLTLSSGQEIVIEERSAKELLCSRGGLGEQVAASGISVWNPAFDVTPANLIT-GIITEKGV 385
            +++IP            M    VSAV+VGADRV ANGDTANKIGTY LA+ AK H I FYVAAP +S DL L +G+EIVIEER ++EL       G ++AA GI VWNPAFDVTP  LIT GIITE GV
Sbjct:  218 YEKIPATLITDSMAAAAMVHQGVSAVVVGADRVVANGDTANKIGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIVIEERPSQELTDLN---GVRIAAQGIRVWNPAFDVTPHELITGGIITELGV 343          
The following BLAST results are available for this feature:
BLAST of CB250284 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 216
Match NameE-valueIdentityDescription
MTNA_DESHY1.491e-3460.77Methylthioribose-1-phosphate isomerase OS=Desulfit... [more]
MTNA_DESHD1.491e-3460.77Methylthioribose-1-phosphate isomerase OS=Desulfit... [more]
MTNA_XENLA1.649e-3358.59Methylthioribose-1-phosphate isomerase OS=Xenopus ... [more]
MTNA_XENTR2.813e-3357.81Methylthioribose-1-phosphate isomerase OS=Xenopus ... [more]
MTNA_SOLUE4.062e-3256.69Methylthioribose-1-phosphate isomerase OS=Solibact... [more]
MTNA_PELTS9.048e-3260.18Methylthioribose-1-phosphate isomerase OS=Pelotoma... [more]
MTNA_RHOBA2.633e-3160.00Methylthioribose-1-phosphate isomerase OS=Rhodopir... [more]
MTNA_GEOMG4.491e-3155.81Methylthioribose-1-phosphate isomerase OS=Geobacte... [more]
MTNA_FERNB4.491e-3160.53Methylthioribose-1-phosphate isomerase OS=Fervidob... [more]
MTNA_RAT5.865e-3158.91Methylthioribose-1-phosphate isomerase OS=Rattus n... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0060 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ077 similar to cytokinin-induced gene CIG2 (acc# BAB63262), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250284 ID=CB250284|Name=CB250284|organism=Citrus sinensis|type=EST|length=490bp
ACATGATCGCATACCAGCTACTCTTATAGCCGACTCTGCTGCGGCTGCAT
TGATGAAAGATGGTCGTGTGAGTGCTGTCATTGTCGGAGCAGATCGAGTG
GCTGCAAATGGTGACACTGCTAACAAGATTGGAACCTACAGCCTTGCATT
ATGTGCAAAGTTTCATAATATTCTGTTTTATGTGGCTGCTCCACTGACGT
CAATTGATTTAACCCTTTCTTCTGGACAAGAGATTGTCATAGAGGAGAGG
TCTGCTAAAGAATTGTTGTGCTCTCGAGGAGGACTTGGTGAACAAGTAGC
TGCATCTGGAATCTCTGTCTGGAATCCGGCTTTTGATGTTACCCCAGCTA
ATTTGATCACTGGAATTATAACAGAAAAGGGTGTCGTTACAAAGGCAGGT
GCTGATGATGCTTTTGACATAAAGGATTTCATACAAAAGACAGTCTGAGG
CTCTGATGCAAAAGAAGGTGATTTTTAACCGGATGAAGTG
back to top