CB250288

Overview
NameCB250288
Unique NameCB250288
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length332
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB250288 vs. ExPASy Swiss-Prot
Match: PGLR_VITVI (Probable polygalacturonase OS=Vitis vinifera GN=GSVIVT00026920001 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.483e-14
Identity = 35/61 (57.38%), Postives = 42/61 (68.85%), Query Frame = 2
Query:    5 IQNISVHAPPESPYTVGIVPDSSDNVCIEDCIIAMGHDAISLKSGWDEYGIAYGRPTTDVL 187
            IQ I++ AP  SP T GI PDS  N  IEDC I  G D +++KSGWDEYGIAYG PT  ++
Sbjct:  235 IQGITILAPVRSPNTDGINPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLV 295          
The following BLAST results are available for this feature:
BLAST of CB250288 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PGLR_VITVI9.483e-1457.38Probable polygalacturonase OS=Vitis vinifera GN=GS... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0064 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ082 similar to unknown Arabidopsis protein (acc# AAM91335), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250288 ID=CB250288|Name=CB250288|organism=Citrus sinensis|type=EST|length=332bp
ACACATTCAAAATATATCAGTCCACGCTCCACCAGAATCGCCATATACTG
TTGGCATAGTTCCAGATTCTTCAGATAATGTCTGCATCGAGGACTGCATC
ATCGCCATGGGGCATGATGCTATTTCTCTAAAGAGTGGTTGGGATGAATA
CGGCATTGCTTATGGCAGACCAACCACAGATGTACTATACTTACTAAAAT
CATAACATGTGTCAAGAAGCGACAGCGCGGGCGCAGTCGGATACTTGGAC
ATAAACTGACGGAATGCTGTCCGCAGAGGGGTGTATGCATCCGGAGGCAG
ACGTGTGATGACAGTTCCGGAGTCTATAATTG
back to top