CB250291

Overview
NameCB250291
Unique NameCB250291
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length594
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig113 contig Csv1_Contig113:1..594. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250291 vs. ExPASy Swiss-Prot
Match: DER22_ARATH (Derlin-2.2 OS=Arabidopsis thaliana GN=DER2.2 PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 8.380e-69
Identity = 126/146 (86.30%), Postives = 134/146 (91.78%), Query Frame = 3
Query:    3 MLLFGATFLTGTVLIGGMIPYLSESFAKIIFLSNSLTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPRMTGRRPLKTPSFIKALFADEAVVVARPANVRFAPPPAEEVHQD 440
            MLLFGA+ LTG VLIGGMIPYLS SFAKIIFLSNSLT MMVYVWSKQNP+IHMSFLGLFTFTAAYLPWVLLGFS+ VGASAWVDLLGMIAGHAYYFL +VYPRMT RRPLKTPSF+KALFADE VVVARP +VRFA  P +E+HQD
Sbjct:   99 MLLFGASVLTGIVLIGGMIPYLSASFAKIIFLSNSLTFMMVYVWSKQNPYIHMSFLGLFTFTAAYLPWVLLGFSILVGASAWVDLLGMIAGHAYYFLAEVYPRMTNRRPLKTPSFLKALFADEPVVVARPEDVRFAAAPFDEIHQD 244          
BLAST of CB250291 vs. ExPASy Swiss-Prot
Match: DER21_ARATH (Derlin-2.1 OS=Arabidopsis thaliana GN=DER2.1 PE=2 SV=2)

HSP 1 Score: 252.292 bits (643), Expect = 1.338e-66
Identity = 123/146 (84.25%), Postives = 131/146 (89.73%), Query Frame = 3
Query:    3 MLLFGATFLTGTVLIGGMIPYLSESFAKIIFLSNSLTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPRMTGRRPLKTPSFIKALFADEAVVVARPANVRFAPPPAEEVHQD 440
            MLLFGAT LTG VLIGGMIPYLS SF+KIIFLSNSLT MMVYVWSKQNP+IHMSFLGLFTFTAAYLPWVLLGFS+ VGASAW D LGMIAGHAYYFL  VYPRMT RRPLKTPSF+KALFADE VV+ARP +VRFA  P +E+HQD
Sbjct:   99 MLLFGATVLTGIVLIGGMIPYLSVSFSKIIFLSNSLTFMMVYVWSKQNPYIHMSFLGLFTFTAAYLPWVLLGFSILVGASAWGDFLGMIAGHAYYFLAFVYPRMTDRRPLKTPSFLKALFADEPVVIARPEDVRFAHAPFDEIHQD 244          
BLAST of CB250291 vs. ExPASy Swiss-Prot
Match: DERL2_ORYSJ (Derlin-2 OS=Oryza sativa subsp. japonica GN=DER2 PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 1.385e-63
Identity = 116/132 (87.88%), Postives = 123/132 (93.18%), Query Frame = 3
Query:    3 MLLFGATFLTGTVLIGGMIPYLSESFAKIIFLSNSLTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPRMTGRRPLKTPSFIKALFADEAVVVARPAN 398
            MLLFGAT LTG VLIGGMIPY+SE+FA+I+FLSNSLT MMVYVWSK NPFIHMSFLGLFTFTAAYLPWVLLGFS+ VG+S WVDLLGMIAGH YYFLEDVYPRMTGRRPLKTPSFIKALFAD+ VVVARP N
Sbjct:   99 MLLFGATVLTGIVLIGGMIPYISETFARILFLSNSLTFMMVYVWSKHNPFIHMSFLGLFTFTAAYLPWVLLGFSILVGSSTWVDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFADDNVVVARPPN 230          
BLAST of CB250291 vs. ExPASy Swiss-Prot
Match: DER22_MAIZE (Derlin-2.2 OS=Zea mays GN=DER2.2 PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 4.028e-63
Identity = 115/132 (87.12%), Postives = 123/132 (93.18%), Query Frame = 3
Query:    3 MLLFGATFLTGTVLIGGMIPYLSESFAKIIFLSNSLTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPRMTGRRPLKTPSFIKALFADEAVVVARPAN 398
            MLLFGAT LTG VLIGGMIPY+SE+FA+I+FLSNSLT MMVYVWSK NPFIHMSFLGLFTFTAAYLPWVLLGFS+ VG+S WVDLLGMIAGH YYFLEDVYPRMTGRRPLKTPSFIKALFAD+ VVVA+P N
Sbjct:   99 MLLFGATVLTGIVLIGGMIPYISETFARILFLSNSLTFMMVYVWSKHNPFIHMSFLGLFTFTAAYLPWVLLGFSILVGSSTWVDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFADDNVVVAQPPN 230          
BLAST of CB250291 vs. ExPASy Swiss-Prot
Match: DER21_MAIZE (Derlin-2.1 OS=Zea mays GN=DER2.1 PE=2 SV=2)

HSP 1 Score: 238.424 bits (607), Expect = 1.999e-62
Identity = 114/132 (86.36%), Postives = 122/132 (92.42%), Query Frame = 3
Query:    3 MLLFGATFLTGTVLIGGMIPYLSESFAKIIFLSNSLTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPRMTGRRPLKTPSFIKALFADEAVVVARPAN 398
            MLLFGAT LT  VLIGGMIPY+SE+FA+I+FLSNSLT MMVYVWSK NPFIHMSFLGLFTFTAAYLPWVLLGFS+ VG+S WVDLLGMIAGH YYFLEDVYPRMTGRRPLKTPSFIKALFAD+ VVVA+P N
Sbjct:   99 MLLFGATVLTSIVLIGGMIPYISETFARILFLSNSLTFMMVYVWSKHNPFIHMSFLGLFTFTAAYLPWVLLGFSILVGSSTWVDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFADDNVVVAQPPN 230          
BLAST of CB250291 vs. ExPASy Swiss-Prot
Match: DERL2_PONAB (Derlin-2 OS=Pongo abelii GN=DERL2 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.599e-27
Identity = 56/108 (51.85%), Postives = 76/108 (70.37%), Query Frame = 3
Query:   42 LIGGMIPYLSESFAKIIFLSNSLTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPRMTGR-RPLKTPSFIKALF 362
            L GG +  L   F  ++FL  + T+M+VYVWS++NP++ M+F GL  F A +LPWVL+GFS+ +G S  VDLLG+  GH Y+FLEDV+P   G  R LKTPS +KA+F
Sbjct:  102 LFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQPGGIRILKTPSILKAIF 209          
BLAST of CB250291 vs. ExPASy Swiss-Prot
Match: DERL2_HUMAN (Derlin-2 OS=Homo sapiens GN=DERL2 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.599e-27
Identity = 56/108 (51.85%), Postives = 76/108 (70.37%), Query Frame = 3
Query:   42 LIGGMIPYLSESFAKIIFLSNSLTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPRMTGR-RPLKTPSFIKALF 362
            L GG +  L   F  ++FL  + T+M+VYVWS++NP++ M+F GL  F A +LPWVL+GFS+ +G S  VDLLG+  GH Y+FLEDV+P   G  R LKTPS +KA+F
Sbjct:  102 LFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDVFPNQPGGIRILKTPSILKAIF 209          
BLAST of CB250291 vs. ExPASy Swiss-Prot
Match: DERL2_MOUSE (Derlin-2 OS=Mus musculus GN=Derl2 PE=2 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 1.354e-26
Identity = 53/108 (49.07%), Postives = 75/108 (69.44%), Query Frame = 3
Query:   42 LIGGMIPYLSESFAKIIFLSNSLTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPRMTGR-RPLKTPSFIKALF 362
            L GG +  L   F  ++FL  + T+M+VYVWS++NP++ M+F GL  F A +LPWVL+GFS+ +G S  VDLLG+  GH Y+FLED++P   G  R LKTPS ++ +F
Sbjct:  102 LFGGFLMTLFGLFVSLVFLGQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGHIYFFLEDIFPNQPGGIRILKTPSILRTIF 209          
BLAST of CB250291 vs. ExPASy Swiss-Prot
Match: DERL2_DICDI (Probable derlin-2 homolog OS=Dictyostelium discoideum GN=derl2 PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.354e-26
Identity = 58/119 (48.74%), Postives = 79/119 (66.39%), Query Frame = 3
Query:    3 MLLFGATFLTGTVLIGGMIPYLSESFAKIIFLSNSLTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYPRMTGRRPLKTPSFIKAL 359
            M +FG+  L    LI     + ++   K++FL+ S+  M++YVWS++NP +H+SFLGLFTF+A YLPWV+L            DLLG +AGHAYYFLED YP ++ RR LKTP F+K L
Sbjct:   99 MWIFGSFLL----LIMDAFLFYTKIVTKVLFLAPSIAFMVIYVWSRRNPNMHISFLGLFTFSAPYLPWVILIMGYLFNHDLTTDLLGAVAGHAYYFLEDAYPLISNRRLLKTPGFLKNL 213          
BLAST of CB250291 vs. ExPASy Swiss-Prot
Match: DERL2_CAEEL (Derlin-2 OS=Caenorhabditis elegans GN=der-2 PE=2 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 3.938e-26
Identity = 55/108 (50.93%), Postives = 78/108 (72.22%), Query Frame = 3
Query:   42 LIGGMIPYLSESFAKIIFLSNSLTLMMVYVWSKQNPFIHMSFLGLFTFTAAYLPWVLLGFSVFVGASAWVDLLGMIAGHAYYFLEDVYP-RMTGRRPLKTPSFIKALF 362
            L G ++  LS  F +I+FL  + T+M+VY+WS++NP I M+F G+ TFTA YLPWVLL FS+ +G +A VD +G+  GH Y+FLEDV+P +  G+R LKTP ++  LF
Sbjct:  100 LFGAVLMILSGIFVQILFLGQAFTIMLVYIWSRRNPMIQMNFFGVLTFTAPYLPWVLLLFSLLLGNNAVVDFMGIACGHIYFFLEDVFPFQEHGKRFLKTPQWLVYLF 207          
The following BLAST results are available for this feature:
BLAST of CB250291 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
DER22_ARATH8.380e-6986.30Derlin-2.2 OS=Arabidopsis thaliana GN=DER2.2 PE=2 ... [more]
DER21_ARATH1.338e-6684.25Derlin-2.1 OS=Arabidopsis thaliana GN=DER2.1 PE=2 ... [more]
DERL2_ORYSJ1.385e-6387.88Derlin-2 OS=Oryza sativa subsp. japonica GN=DER2 P... [more]
DER22_MAIZE4.028e-6387.12Derlin-2.2 OS=Zea mays GN=DER2.2 PE=2 SV=1[more]
DER21_MAIZE1.999e-6286.36Derlin-2.1 OS=Zea mays GN=DER2.1 PE=2 SV=2[more]
DERL2_PONAB1.599e-2751.85Derlin-2 OS=Pongo abelii GN=DERL2 PE=2 SV=1[more]
DERL2_HUMAN1.599e-2751.85Derlin-2 OS=Homo sapiens GN=DERL2 PE=1 SV=1[more]
DERL2_MOUSE1.354e-2649.07Derlin-2 OS=Mus musculus GN=Derl2 PE=2 SV=2[more]
DERL2_DICDI1.354e-2648.74Probable derlin-2 homolog OS=Dictyostelium discoid... [more]
DERL2_CAEEL3.938e-2650.93Derlin-2 OS=Caenorhabditis elegans GN=der-2 PE=2 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0068 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ091 similar to unknown Arabidopsis protein (acc# NP_192395), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250291 ID=CB250291|Name=CB250291|organism=Citrus sinensis|type=EST|length=594bp
ACATGCTTTTATTTGGAGCCACTTTTCTAACCGGCACTGTTCTTATTGGG
GGGATGATACCTTACTTGTCAGAATCATTTGCAAAAATCATTTTCCTTAG
CAATTCATTGACACTCATGATGGTTTATGTATGGAGCAAACAAAATCCTT
TCATCCACATGAGTTTTTTGGGCCTTTTTACATTTACAGCAGCTTACTTA
CCATGGGTGCTCTTGGGATTCTCAGTCTTCGTTGGCGCTAGCGCTTGGGT
GGATTTGCTGGGGATGATAGCCGGTCATGCCTACTATTTTCTCGAAGATG
TTTATCCTAGGATGACAGGTCGCCGGCCCTTAAAAACACCATCTTTTATC
AAAGCACTGTTTGCGGATGAGGCTGTAGTGGTAGCACGGCCTGCAAATGT
GAGATTTGCTCCACCACCTGCAGAGGAAGTTCACCAAGACTAATGAGAAC
CTTTGAGGGATGGGACTCTCTTGAGGGCTCACTTTTGGTTTGTATTGATC
TGTATGGGAAATCTGCGACCTGCAGAAAGTGTTGTTGACCCATGTCTTGA
AAGTATTTATGTGAACTAGCTAATTATGGTGTTTATGTCATAAG
back to top