CB250300

Overview
NameCB250300
Unique NameCB250300
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length437
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10169 contig Csv1_Contig10169:164..600. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ1_ANASP (Arginine biosynthesis bifunctional protein argJ 1 OS=Anabaena sp. (strain PCC 7120) GN=argJ1 PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 7.907e-30
Identity = 67/117 (57.26%), Postives = 81/117 (69.23%), Query Frame = 1
Query:   73 EAKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYLRKA 423
            E+++L+A L  V Q LAK+ A DGEGATCLIEV+VTGA+ E  A +I              +GRDPNWGRIAAAAG AGV F Q  L++ LGD LL+D GQPLPFDRA A  YL++A
Sbjct:  253 ESEKLEAMLTAVCQHLAKAIARDGEGATCLIEVQVTGAHDEQAARQIAKTIAGSSLVKSAIFGRDPNWGRIAAAAGRAGVPFEQENLQIQLGDFLLLDNGQPLPFDRAAASAYLKQA 369          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_SYNY3 (Arginine biosynthesis bifunctional protein argJ OS=Synechocystis sp. (strain PCC 6803) GN=argJ PE=3 SV=2)

HSP 1 Score: 117.472 bits (293), Expect = 2.381e-26
Identity = 61/116 (52.59%), Postives = 76/116 (65.52%), Query Frame = 1
Query:   76 AKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYLRKA 423
            A++L+A L  V Q LAK+ A DGEGATCL+E++VTGA  +  A  +              +GRDPNWGRIA AAG AGV F QN L + LG+ +LMD GQPL FDR  A NYL++A
Sbjct:  254 AEKLEAMLTAVCQHLAKAIARDGEGATCLMEIQVTGAPDDQSARAVARTIAGSSLVKSAVFGRDPNWGRIAGAAGRAGVKFDQNNLLIKLGNYVLMDQGQPLEFDRPGASNYLKQA 369          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_SYNP6 (Arginine biosynthesis bifunctional protein argJ OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=argJ PE=3 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.000e-24
Identity = 62/114 (54.39%), Postives = 69/114 (60.53%), Query Frame = 1
Query:   76 AKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYLR 417
            A QL+A L  V Q LAK+ A DGEGATCLIEV+V G   +A A  I              +GRDPNWGRIAAAAG AGV F    L V LG+  L+  GQPLPFDR  A  YLR
Sbjct:  256 ADQLEAMLTAVCQHLAKAIARDGEGATCLIEVQVKGTADDAAARAIARTIAGSSLVKSAIFGRDPNWGRIAAAAGRAGVQFNSENLGVRLGEFELLRNGQPLPFDRNAASQYLR 369          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_THEEB (Arginine biosynthesis bifunctional protein argJ OS=Thermosynechococcus elongatus (strain BP-1) GN=argJ PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.724e-22
Identity = 57/113 (50.44%), Postives = 69/113 (61.06%), Query Frame = 1
Query:   76 AKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYL 414
            A +L+  L  V   LAK+ A DGEGATCLIEV+V+GA+ +  A ++              YGRDPNWGRIAAAAG AGV F  + L + LG   +M  GQPLPFD A A  YL
Sbjct:  254 ATRLEEMLTAVCVHLAKAIARDGEGATCLIEVQVSGASDDTAARQVARTIASSMLVKSAIYGRDPNWGRIAAAAGRAGVPFDASNLAIALGGIPMMRHGQPLPFDPAAAHAYL 366          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_PROMM (Arginine biosynthesis bifunctional protein argJ OS=Prochlorococcus marinus (strain MIT 9313) GN=argJ PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 3.934e-21
Identity = 54/112 (48.21%), Postives = 68/112 (60.71%), Query Frame = 1
Query:   85 LQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYLRK 420
            L+A L V  Q LAK+ A DGEGATCL+EV+V G   + EA +I              +GRDPNWGRI AAAG AGV F    + + LG   LM+ G+PLPFDR  A  Y+++
Sbjct:  271 LEAGLLVAAQQLAKAIARDGEGATCLLEVQVEGVVGDVEARRIARTVCGSSLVKTAVHGRDPNWGRIVAAAGCAGVPFDPAAVALWLGPHQLMEFGEPLPFDRLAASRYMQE 382          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_GLOVI (Arginine biosynthesis bifunctional protein argJ OS=Gloeobacter violaceus GN=argJ PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 6.710e-21
Identity = 56/115 (48.70%), Postives = 66/115 (57.39%), Query Frame = 1
Query:   73 EAKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYLR 417
            EA  L+  +  V   LAK    DGEGAT LIEV+V G   +A+A KI              +G DPNWGR+AAAAG AGV F    L V LG   LM+ GQPL FDRA A +YL+
Sbjct:  254 EAGLLEQMVSAVCVDLAKKVVRDGEGATKLIEVQVAGTGDDAQARKIALTVASSSLVKSAMFGNDPNWGRLAAAAGRAGVEFDPAALAVRLGAFALMEVGQPLAFDRAAASDYLK 368          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_SYNPX (Arginine biosynthesis bifunctional protein argJ OS=Synechococcus sp. (strain WH8102) GN=argJ PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.265e-19
Identity = 58/139 (41.73%), Postives = 71/139 (51.08%), Query Frame = 1
Query:    1 TNDTVIXXXXXXXXXXXXXXVDCNEAKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYLR 417
            TNDTV+              +D      L+  L   MQ LAK+ A DGEGATCLIEV+V GA  E  A ++              +GRDPNWGRI AAAG +GV F   ++ + +G   LM  GQPL FD   A   LR
Sbjct:  241 TNDTVLAFAAGDP-------LDSVHHAALEQGLTEAMQHLAKAIARDGEGATCLIEVQVEGALDEPSAQRVARTIVGSSLVKTAVHGRDPNWGRIVAAAGRSGVPFDPEQVALWIGPHQLMQSGQPLSFDPEAASRVLR 372          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_PROMT (Arginine biosynthesis bifunctional protein argJ OS=Prochlorococcus marinus (strain NATL2A) GN=argJ PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.399e-18
Identity = 46/111 (41.44%), Postives = 64/111 (57.66%), Query Frame = 1
Query:   85 LQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYLR 417
            L+  L +  Q LAKS A DGEGA CL+E++V GA+S+ +A  I              +G DPNWGRI AA G AG SF  N +++ +G   +   G PL FDR +  N+++
Sbjct:  264 LEEGLHLTAQHLAKSIARDGEGANCLLEIKVEGASSDLDARAIARTIASSSLVKTAVHGSDPNWGRIIAALGRAGTSFNLNDVKLWIGPYEIFSNGTPLDFDRQIVSNFMK 374          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_PROMP (Arginine biosynthesis bifunctional protein argJ OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=argJ PE=3 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.003e-16
Identity = 45/119 (37.82%), Postives = 67/119 (56.30%), Query Frame = 1
Query:   61 VDCNEAKQLQACLDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYLR 417
            +D     ++Q+ +D+V Q LAK+ A DGEGA CL+EV V GA S ++A KI               G DPNWGRI +AAG +G+ F  + L + +GD  ++  G+   +D     NY++
Sbjct:  238 IDKKFLSKIQSGIDIVCQSLAKNIARDGEGANCLLEVLVEGAKSNSDAIKIAKSICNSSLVKTAINGCDPNWGRIISAAGNSGIDFKLDFLDLYIGDFQILKKGKLNKYDSKKVANYMQ 356          
BLAST of CB250300 vs. ExPASy Swiss-Prot
Match: ARGJ_SYMTH (Arginine biosynthesis bifunctional protein argJ OS=Symbiobacterium thermophilum GN=argJ PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.917e-16
Identity = 46/108 (42.59%), Postives = 60/108 (55.56%), Query Frame = 1
Query:   97 LDVVMQGLAKSTAWDGEGATCLIEVRVTGANSEAEAAKIXXXXXXXXXXXXXXYGRDPNWGRIAAAAGYAGVSFYQNKLRVLLGDSLLMDGGQPLPFDRAVAGNYLRK 420
            L  V+  LAK  A DGEGAT LIEVRV GA + ++A K               +G D NWGR+ AA GY+G  F   ++ + LGD  +M  G+P+ FD A A   LR+
Sbjct:  259 LAAVLIHLAKEIARDGEGATKLIEVRVKGAATLSDARKAARAVCGSNLVKAAVFGEDANWGRVLAALGYSGAQFDPGRVDLWLGDLQMMRAGEPVAFDEAAAARVLRE 366          
The following BLAST results are available for this feature:
BLAST of CB250300 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 47
Match NameE-valueIdentityDescription
ARGJ1_ANASP7.907e-3057.26Arginine biosynthesis bifunctional protein argJ 1 ... [more]
ARGJ_SYNY32.381e-2652.59Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_SYNP61.000e-2454.39Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_THEEB2.724e-2250.44Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_PROMM3.934e-2148.21Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_GLOVI6.710e-2148.70Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_SYNPX1.265e-1941.73Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_PROMT1.399e-1841.44Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_PROMP1.003e-1637.82Arginine biosynthesis bifunctional protein argJ OS... [more]
ARGJ_SYMTH2.917e-1642.59Arginine biosynthesis bifunctional protein argJ OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0079 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ107 similar to putative glutamate/ornithine acetyltransferase (acc# NP_565863), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250300 ID=CB250300|Name=CB250300|organism=Citrus sinensis|type=EST|length=437bp
ACCAATGATACTGTCATAGCTTTGGCTAGTGGGTTATCTAGATCAAGCAG
GTTATCTTCTGTTGACTGTAACGAAGCCAAGCAACTTCAAGCATGCCTTG
ATGTGGTAATGCAAGGTCTTGCCAAGTCTACAGCTTGGGATGGAGAAGGA
GCAACGTGCTTAATTGAGGTCAGAGTGACCGGTGCTAACAGTGAGGCTGA
AGCAGCCAAGATCGCCCGCTCAGTGGCATCTTCTTCACTTGTCAAGGCAG
CTGTATACGGCAGAGATCCGAACTGGGGACGCATTGCTGCAGCTGCTGGA
TATGCAGGGGTTTCTTTCTACCAAAACAAGCTCCGCGTATTGCTTGGAGA
TAGTTTGCTCATGGATGGTGGGCAACCACTCCCATTTGACAGGGCTGTGG
CTGGTAACTATCTCAGGAAGGCTGGTGAGACCCGCGG
back to top