CB250309

Overview
NameCB250309
Unique NameCB250309
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length425
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13457 contig Csv1_Contig13457:761..1185. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250309 vs. ExPASy Swiss-Prot
Match: C76B1_HELTU (7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.250e-29
Identity = 66/139 (47.48%), Postives = 95/139 (68.35%), Query Frame = 1
Query:    7 IHIGQAAFDTTLNLISNTIFSIDLADPTSKTAREFKQINWGMMEEAGKPNLSDFFPALENLDLQGIRRRMTVYFGKMLDVFDRLIDQRLKQRQERDFTESKDMLDALLKICEDKSVEIDINDIKHLFLVLFTAGTDTTS 423
            +HIG+AAF T+LNL+SNTIFS DL DP   + +EF+++   +M ++ K NL D FP L+ +D QGI+R M  +F K+L +FD+LI++R++  +     E  D+LD  LK+ +D   E +  +IK LFL LF AGTDTTS
Sbjct:  165 VHIGRAAFRTSLNLLSNTIFSKDLTDPYEDSGKEFREVITNIMVDSAKTNLVDVFPVLKKIDPQGIKRGMARHFSKVLGIFDQLIEERMRTGR----FEQGDVLDVCLKMMQDNPNEFNHTNIKALFLDLFVAGTDTTS 299          
BLAST of CB250309 vs. ExPASy Swiss-Prot
Match: C76C4_ARATH (Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 2.697e-24
Identity = 58/143 (40.56%), Postives = 92/143 (64.34%), Query Frame = 1
Query:    4 AIHIGQAAFDTTLNLISNTIFSIDLADPTSKTAREFKQINWGMMEEAGKPNLSDFFPALENLDLQGIRRRMTVYFGKMLDVFDRLIDQRLKQRQERDFTE---SKDMLDALLKICEDKSVEIDINDIKHLFLVLFTAGTDTTS 423
            A+ I +A++ T LN+ISN +FS+DL    SK + EF+    G ME AGKP+ +++FP +  LDLQG R+ M     ++  VF   +D ++ ++   ++++   ++D LD+LL + E    E+D NDI+HL L +FTAGTDT+S
Sbjct:  175 AVDISRASYTTVLNIISNILFSVDLGSYDSKKSNEFQDTVIGAMEAAGKPDAANYFPFMGFLDLQGNRKAMRGLTERLFRVFRGFMDAKIAEKSLGNYSKDVSNRDFLDSLLILNEGDEAELDNNDIEHLLLDMFTAGTDTSS 317          
BLAST of CB250309 vs. ExPASy Swiss-Prot
Match: C76C3_ARATH (Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 1.133e-22
Identity = 60/146 (41.10%), Postives = 86/146 (58.90%), Query Frame = 1
Query:    4 AIHIGQAAFDTTLNLISNTIFSIDLADPTSKTAR-EFKQINWGMMEEAGKPNLSDFFPALENLDLQGIRRRMTVYFGKMLDVFDRLIDQRLKQRQERDFTESK-----DMLDALLKICEDKSVEIDINDIKHLFLVLFTAGTDTTS 423
            AI + +A+F T+ N+ISN +FS+DLA   S ++  EF      + + AG PN+ D+F  +  LDLQG R++  +   K+  VF   ID RL +R  R   E K     DMLD+LL + +    E+ +ND+KHL L +F AGTDT S
Sbjct:  174 AIDLARASFVTSFNIISNALFSVDLATYDSNSSSYEFHNTVVHLTDIAGIPNVGDYFQYMRFLDLQGTRKKAVLCIEKLFRVFQEFIDARLAKRFSRTEKEPKEASSIDMLDSLLDLTQQNEAELTMNDLKHLLLDVFVAGTDTNS 319          
BLAST of CB250309 vs. ExPASy Swiss-Prot
Match: C76C2_ARATH (Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.525e-22
Identity = 61/145 (42.07%), Postives = 85/145 (58.62%), Query Frame = 1
Query:    4 AIHIGQAAFDTTLNLISNTIFSIDLADPTSKTAREFKQINWGMMEEAGKPNLSDFFPALENLDLQGIRRRMTVYFGKMLDVFDRLIDQRLKQRQERDFTESKDM-----LDALLKICEDKSVEIDINDIKHLFLVLFTAGTDTTS 423
            A+ I +A F T LN+ISN +FS+DL +  S  +  F+    G+ME  G P+ ++FFP L  LDLQG R+ +     ++  VF   ID +L ++  RD T SKD+     +D LL + E    E++ NDI HL L LF AGTDT S
Sbjct:  175 AVDISRATFITALNIISNILFSVDLGNYDSNKSGVFQDTVIGVMEAVGNPDAANFFPFLGFLDLQGNRKTLKACSERLFKVFRGFIDAKLAEKSLRD-TNSKDVRERDFVDVLLDLTEGDEAELNTNDIVHLLLDLFGAGTDTNS 318          
BLAST of CB250309 vs. ExPASy Swiss-Prot
Match: C76A1_SOLME (Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.297e-18
Identity = 53/144 (36.81%), Postives = 87/144 (60.42%), Query Frame = 1
Query:    7 IHIGQAAFDTTLNLISNTIFSIDLA-DPTSKTAREFKQINWGMMEEAGKPNLSDFFPALENLDLQGIRRRMTVYFGKMLDVFDRLIDQRLKQRQERDFTES-KDMLDALLKI---CEDKSVEIDINDIKHLFLVLFTAGTDTTS 423
            I + +  F  + N++ N IFS DL  DP SK   EF     G+ME AG PN+SD FP L+  D+QG+R++M    GK  ++  + I++R+++R++ +   S KD+LD L+      +D+  ++  ++I  + L +F AGT+TTS
Sbjct:  134 IEVTRYMFLASFNMVGNMIFSKDLVTDPESKQGSEFFNAMIGIMEWAGVPNISDIFPCLKMFDVQGLRKKMERDMGKGKEITKKFIEERIEERKKGEKNRSIKDLLDVLIDFEGSGKDEPDKLSEDEITVIILEMFLAGTETTS 277          
BLAST of CB250309 vs. ExPASy Swiss-Prot
Match: C76C1_ARATH (Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.872e-17
Identity = 54/144 (37.50%), Postives = 85/144 (59.03%), Query Frame = 1
Query:    4 AIHIGQAAFDTTLNLISNTIFSIDLADPTSKTAREFKQINW-GMMEEAGKPNLSDFFPALENLDLQGIRRRMTVYFGKMLDVFDRLIDQRLKQRQERD---FTESKDMLDALLKICEDKSVEIDINDIKHLFLVLFTAGTDTTS 423
            ++ I + AF TTLN+ISN +FS+DL    +K +    Q     +M+ AG P+ +++FP L  LDLQG  +   V   +++ VF   ID ++ ++  ++        D +D LL    D+S E+ I+DI+HL L +FTAGTDT+S
Sbjct:  175 SVDISRVAFITTLNIISNILFSVDLGSYNAKASINGVQDTVISVMDAAGTPDAANYFPFLRFLDLQGNVKTFKVCTERLVRVFRGFIDAKIAEKSSQNNPKDVSKNDFVDNLLDYKGDES-ELSISDIEHLLLDMFTAGTDTSS 317          
BLAST of CB250309 vs. ExPASy Swiss-Prot
Match: C76A2_SOLME (Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 5.099e-15
Identity = 51/148 (34.46%), Postives = 84/148 (56.76%), Query Frame = 1
Query:    1 TAIHIGQAAFDTTLNLISNTIFSIDLADPTSKTAREF----KQINWGMMEEAGKPNLSDFFPALENLDLQGIRRRMTVYFGKMLDVFDRLIDQRLKQRQERDFTESKDMLDALLKI---CEDKSVEIDINDIKHLFLVLFTAGTDTTS 423
            + I + +  F  + N++ N I S DLAD  S+ A EF    K+IN    E +G  N+SD FP L+  DLQ +R++M    GK +++    + +R ++R ++   + KD LD LL+     +D+  ++  ++IK   L +F AGT+TTS
Sbjct:  173 SGIEVTRFVFLASFNMLGNLILSKDLADLESEEASEFFIAMKRIN----EWSGIANVSDIFPFLKKFDLQSLRKKMARDMGKAVEIMSMFLKEREEER-KKGTEKGKDFLDVLLEFQGTGKDEPAKLSEHEIKIFVLEMFLAGTETTS 315          
BLAST of CB250309 vs. ExPASy Swiss-Prot
Match: C93A3_SOYBN (Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.142e-13
Identity = 51/150 (34.00%), Postives = 75/150 (50.00%), Query Frame = 1
Query:    4 AIHIGQAAFDTTLNLISNTIFSIDLADPTSKTAREFKQINWGMMEEAGKPNLSDFFPALENLDLQGIRRRMTVYFGKMLDVFDRLIDQRLKQRQER--------DFTESKDMLDALLKICEDKSVEIDIN--DIKHLFLVLFTAGTDTTS 423
            A+  G      + N++S  I S            E +++     E +GK N+SDF   L+  DLQG  +R+     K+ D FD ++D+ +KQR+E            E KDMLD L  I ED+S EI +N  +IK   L +  AGTDT++
Sbjct:  168 AVDFGGEFITLSNNIVSRMIVSQTSTTEDENEVEEMRKLVKDAAELSGKFNISDFVSFLKRFDLQGFNKRLE----KIRDCFDTVLDRIIKQREEERRNKNETVGKREFKDMLDVLFDISEDESSEIKLNKENIKAFILDILIAGTDTSA 313          
BLAST of CB250309 vs. ExPASy Swiss-Prot
Match: C93A1_SOYBN (Cytochrome P450 93A1 OS=Glycine max GN=CYP93A1 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.093e-12
Identity = 51/144 (35.42%), Postives = 77/144 (53.47%), Query Frame = 1
Query:   31 DTTLNLISNTIFSIDLADPTSKT---AREFKQINWGMMEEAGKPNLSDFFPALENLDLQGIRRRMTVYFGKMLDVFDRLIDQRLKQRQER--------DFTESKDMLDALLKICEDKSVEI--DINDIKHLFLVLFTAGTDTTS 423
            D  + L +N +  + L+  TS+    A E K++   + E  GK N+SDF   L+  DLQG  R++     +  D FD ++D  +KQRQE            + KDMLD LL + ED++ EI  D  +IK   + +F AGTDT++
Sbjct:  173 DELMTLSNNIVSRMTLSQKTSENDNQAEEMKKLVSNIAELMGKFNVSDFIWYLKPFDLQGFNRKIK----ETRDRFDVVVDGIIKQRQEERRKNKETGTAKQFKDMLDVLLDMHEDENAEIKLDKKNIKAFIMDIFVAGTDTSA 312          
BLAST of CB250309 vs. ExPASy Swiss-Prot
Match: C75A6_CAMME (Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.619e-11
Identity = 44/122 (36.07%), Postives = 69/122 (56.56%), Query Frame = 1
Query:   70 IDLADPTSKTAREFKQINWGMMEEAGKPNLSDFFPALENLDLQGIRRRMTVYFGKMLDVFDRLIDQRLKQRQE--RDFTESKDMLDALLKICEDKSVEIDIN--DIKHLFLVLFTAGTDTTS 423
            +D +   S +  EF+ +   +M  AG  N+ DF P +  +DLQGI+R M V   K    FD L+++ +K+  E   D  ++ D LD L+   ++ +  I +N  ++K L L LFTAGTDT+S
Sbjct:  207 LDSSASASASVSEFQYMVMELMRMAGLFNIGDFIPYIAWMDLQGIQRDMKVIQKK----FDVLLNKMIKEHTESAHDRKDNPDFLDILMAATQENTEGIQLNLVNVKALLLDLFTAGTDTSS 324          
The following BLAST results are available for this feature:
BLAST of CB250309 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
C76B1_HELTU1.250e-2947.487-ethoxycoumarin O-deethylase OS=Helianthus tubero... [more]
C76C4_ARATH2.697e-2440.56Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CY... [more]
C76C3_ARATH1.133e-2241.10Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CY... [more]
C76C2_ARATH2.525e-2242.07Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CY... [more]
C76A1_SOLME1.297e-1836.81Cytochrome P450 76A1 (Fragment) OS=Solanum melonge... [more]
C76C1_ARATH1.872e-1737.50Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CY... [more]
C76A2_SOLME5.099e-1534.46Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76... [more]
C93A3_SOYBN2.142e-1334.00Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=... [more]
C93A1_SOYBN3.093e-1235.42Cytochrome P450 93A1 OS=Glycine max GN=CYP93A1 PE=... [more]
C75A6_CAMME2.619e-1136.07Flavonoid 3',5'-hydroxylase OS=Campanula medium GN... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0094 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ132 similar to 7-ethoxycourmain O-deethylase (acc# CAB85635), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250309 ID=CB250309|Name=CB250309|organism=Citrus sinensis|type=EST|length=425bp
ACAGCAATACATATTGGCCAAGCTGCTTTTGACACTACGCTTAATTTGAT
ATCCAACACAATTTTTTCTATTGACTTGGCTGATCCCACATCAAAAACTG
CGCGAGAGTTTAAGCAAATAAATTGGGGTATGATGGAAGAAGCTGGAAAG
CCTAACTTGTCCGATTTTTTTCCTGCGCTTGAGAATCTTGACTTGCAAGG
TATAAGGCGTCGCATGACAGTTTATTTTGGCAAGATGCTCGATGTATTTG
ATCGCTTGATTGATCAACGATTGAAGCAAAGACAAGAACGAGATTTCACC
GAATCCAAAGATATGTTAGATGCTCTTCTCAAAATTTGTGAAGACAAAAG
CGTGGAGATTGATATAAATGATATCAAACACTTGTTTCTGGTTTTGTTTA
CTGCGGGGACTGATACTACTTCGAG
back to top