CB250318

Overview
NameCB250318
Unique NameCB250318
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length311
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7130 contig Csv1_Contig7130:252..562. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250318 vs. ExPASy Swiss-Prot
Match: INT1_ARATH (Probable inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 4.194e-30
Identity = 66/103 (64.08%), Postives = 78/103 (75.73%), Query Frame = 3
Query:    3 MLGVSAVPAIIQFVLMLFMPESPRWLFMKSDKEKAILVLSKIYDIARLEDEIDHLSAAAEEELRKKKTVRYLDVFKSKEIRXXXXXXXXXXXXXXXXXINTVM 311
            MLGVS VPA+IQF+LMLFMPESPRWLFMK+ K +AI VL++ YDI+RLEDEIDHLSAA EEE ++K+TV YLDVF+SKE+R                 INTVM
Sbjct:  193 MLGVSGVPAVIQFILMLFMPESPRWLFMKNRKAEAIQVLARTYDISRLEDEIDHLSAAEEEEKQRKRTVGYLDVFRSKELRLAFLAGAGLQAFQQFTGINTVM 295          
BLAST of CB250318 vs. ExPASy Swiss-Prot
Match: INT2_ARATH (Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.151e-12
Identity = 37/106 (34.91%), Postives = 59/106 (55.66%), Query Frame = 3
Query:    3 MLGVSAVPAIIQFVLMLFMPESPRWLFMKSDKEKAILVLSKIYDIARLEDEIDHLSAAAEEELRKK---KTVRYLDVFKSKEIRXXXXXXXXXXXXXXXXXINTVM 311
            MLG++ +PA++QFVLM  +PESPRWL+ K  +E+A  +L +IY    +E EI  L  + E E+ ++   + +  + + K+K +R                 INTVM
Sbjct:  190 MLGIAGIPALLQFVLMFTLPESPRWLYRKGREEEAKAILRRIYSAEDVEQEIRALKDSVETEILEEGSSEKINMIKLCKAKTVRRGLIAGVGLQVFQQFVGINTVM 295          
The following BLAST results are available for this feature:
BLAST of CB250318 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
INT1_ARATH4.194e-3064.08Probable inositol transporter 1 OS=Arabidopsis tha... [more]
INT2_ARATH5.151e-1234.91Probable inositol transporter 2 OS=Arabidopsis tha... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0103 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ145 similar to putative membrane transporter (acc# NP_181861), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250318 ID=CB250318|Name=CB250318|organism=Citrus sinensis|type=EST|length=311bp
GGATGCTTGGAGTATCAGCTGTGCCAGCTATCATTCAGTTTGTCTTAATG
CTTTTTATGCCGGAGTCTCCTAGATGGCTTTTCATGAAGAGTGACAAAGA
AAAAGCCATTTTGGTTCTTTCTAAGATTTATGACATTGCTCGGTTAGAAG
ATGAAATTGATCACCTTTCAGCTGCTGCAGAGGAAGAACTCCGAAAAAAG
AAAACTGTCAGATACTTGGATGTTTTTAAATCCAAAGAAATCAGACTTGC
ATTTCTGGCTGGGGCTGGACTTCAGGCATTTCAGCAGTTCACTGGTATCA
ACACAGTCATG
back to top