CB250319

Overview
NameCB250319
Unique NameCB250319
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length708
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig115 contig Csv1_Contig115:1..708. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250319 vs. ExPASy Swiss-Prot
Match: PGLR_PRUPE (Polygalacturonase OS=Prunus persica PE=2 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 1.478e-95
Identity = 163/210 (77.62%), Postives = 184/210 (87.62%), Query Frame = 2
Query:    2 QGVKVSAAGDSPNTDGIHVQASSGVTILDSKIGTGDDCVSVGPGATNLWIENVACGPGHGISIGSLGKEQQEAGVQNVTVTSVTFTGTQNGVRIKSWGRPSNGFARNILFQHALMNNVDNPIIIDQNYCPDNNNCPGQASGVKISDVIYQDIHGTSATEVGVKLDCSSKNPCTGISLEDVKLIYKNQPAEASCANADGSASGFILPNSCL 631
            QGV+VS +G+SPNTDGIHVQ SSGVTIL+SKI TGDDCVS+GPG +NLWIE VACGPGHGISIGSLGKEQ+EAGVQNVTV +VTF+GTQNG+RIKSWGRPS GFARNILFQHA M NV+NPI+IDQ+YCPDN  CPGQ SGV+ISDV Y+DIHGTSATEV VK DCS K+PC  I LEDVKL YKNQ AE+SC++ADG+  G + P SCL
Sbjct:  184 QGVRVSRSGNSPNTDGIHVQMSSGVTILNSKIATGDDCVSIGPGTSNLWIEGVACGPGHGISIGSLGKEQEEAGVQNVTVKTVTFSGTQNGLRIKSWGRPSTGFARNILFQHATMVNVENPIVIDQHYCPDNKGCPGQVSGVQISDVTYEDIHGTSATEVAVKFDCSPKHPCREIKLEDVKLTYKNQAAESSCSHADGTTEGVVQPTSCL 393          
BLAST of CB250319 vs. ExPASy Swiss-Prot
Match: PGLR6_ARATH (Probable polygalacturonase At2g43860 OS=Arabidopsis thaliana GN=At2g43860 PE=2 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 4.625e-73
Identity = 131/210 (62.38%), Postives = 166/210 (79.05%), Query Frame = 2
Query:    5 GVKVSAAGDSPNTDGIHVQASSGVTILDSKIGTGDDCVSVGPGATNLWIENVACGPGHGISIGSLGKEQQEAGVQNVTVTSVTFTGTQNGVRIKSWGRPSNGFARNILFQHALMNNVDNPIIIDQNYCPDNNNCPGQASGVKISDVIYQDIHGTSATEVGVKLDCSSKNPCTGISLEDVKLIYKNQPAEASCANADGSASGFILPNSCLK 634
            GVKVSA  +SPNTDGIHV++S  V I +S+IGTGDDC+S+GPG+TN++I+ + CGPGHGISIGSLG+ ++E GV NVTV++V F GT NGVRIK+WG+ SN FARNI+FQH  M  V NPIIIDQ+YC  +  CP Q SGVK+S+V Y+DIHGTS TEV V LDCS + PCTGI ++DV L+  ++PA+ASC NA+GSA+  +    CLK
Sbjct:  191 GVKVSADENSPNTDGIHVESSHSVHITNSRIGTGDDCISIGPGSTNVFIQTIRCGPGHGISIGSLGRAEEEQGVDNVTVSNVDFMGTNNGVRIKTWGKDSNSFARNIVFQHINMKMVKNPIIIDQHYCL-HKPCPKQESGVKVSNVRYEDIHGTSNTEVAVLLDCSKEKPCTGIVMDDVNLVSVHRPAQASCDNANGSANDVVPFTPCLK 399          
BLAST of CB250319 vs. ExPASy Swiss-Prot
Match: PGLR2_ARATH (Exopolygalacturonase clone GBGA483 OS=Arabidopsis thaliana GN=At3g07850 PE=1 SV=2)

HSP 1 Score: 203.756 bits (517), Expect = 7.677e-52
Identity = 104/209 (49.76%), Postives = 135/209 (64.59%), Query Frame = 2
Query:    8 VKVSAAGDSPNTDGIHVQASSGVTILDSKIGTGDDCVSVGPGATNLWIENVACGPGHGISIGSLGKEQQEAGVQNVTVTSVTFTGTQNGVRIKSWGRPSNGFARNILFQHALMNNVDNPIIIDQNYCPDNNNCPGQASGVKISDVIYQDIHGTSATEVGVKLDCSSKNPCTGISLEDVKLIY--KNQPAEASCANADGSASGFILPNSC 628
            + + A  +S NTDGIH+  S+GV ++ +KI TGDDCVS+G G  NL +ENV CGPGHGISIGSLG+   E  V+ VTV       T NGVRIK+W     G A NILF+   M+NV  P++IDQ YCP  +   G  S VK+SDV  + I GTSAT+V VKL CS   PCT I+L D+ L++  K  PA ++C+N     SG ++P +C
Sbjct:  228 IGIDAPPESLNTDGIHIGRSNGVNLIGAKIKTGDDCVSIGDGTENLIVENVECGPGHGISIGSLGRYPNEQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPYGHCKAGVPSQVKLSDVTIKGIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKPILSGKLVPAAC 436          
BLAST of CB250319 vs. ExPASy Swiss-Prot
Match: QRT2_ARATH (Polygalacturonase QRT2 OS=Arabidopsis thaliana GN=QRT2 PE=1 SV=2)

HSP 1 Score: 202.601 bits (514), Expect = 1.710e-51
Identity = 99/204 (48.53%), Postives = 136/204 (66.67%), Query Frame = 2
Query:   14 VSAAGDSPNTDGIHVQASSGVTILDSKIGTGDDCVSVGPGATNLWIENVACGPGHGISIGSLGKEQQEAGVQNVTVTSVTFTGTQNGVRIKSWGRPSNGFARNILFQHALMNNVDNPIIIDQNYCPDNNNCPGQASGVKISDVIYQDIHGTSATEVGVKLDCSSKNPCTGISLEDVKLIYKNQP--AEASCANADGSASGFILP 619
            V++  DSPNTDGIHV  +  + I DS + TGDDC+S+  G+ N+    + CGPGHGISIGSLG++  EA V NV V   T  GT NGVRIK+W +  +G A+NI+FQ  +M NV NPIII+Q+YC     CP Q S V++S+V+Y++I GTS+  + VK  CS   PC GIS+++VKL+ + Q   ++ASC+N      G + P
Sbjct:  234 VTSPADSPNTDGIHVSGTQNILIQDSIVRTGDDCISIVSGSENVRATGITCGPGHGISIGSLGEDNSEAYVSNVVVNKATLIGTTNGVRIKTW-QGGHGMAKNIIFQDIIMKNVTNPIIINQDYCDRVEACPEQKSAVQVSNVLYKNIQGTSSRPIAVKFVCSKNIPCRGISMQNVKLVDQTQQDVSKASCSNVKLDTRGNVSP 436          
BLAST of CB250319 vs. ExPASy Swiss-Prot
Match: ADPG1_ARATH (Polygalacturonase ADPG1 OS=Arabidopsis thaliana GN=ADPG1 PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 4.213e-50
Identity = 99/204 (48.53%), Postives = 138/204 (67.65%), Query Frame = 2
Query:    8 VKVSAAGDSPNTDGIHVQASSGVTILDSKIGTGDDCVSVGPGATNLWIENVACGPGHGISIGSLGKEQQEAGVQNVTVTSVTFTGTQNGVRIKSWGRPSNGFARNILFQHALMNNVDNPIIIDQNYCPDNNNCPGQASGVKISDVIYQDIHGTSATEVGVKLDCSSKNPCTGISLEDVKLIYKNQPAEASCANADGSASGFILP 619
            V+++A GDSPNTDGIH+  +  + + +S IGTGDDC+S+  G  NL I ++ CGPGHGISIGSLG +  +A V  + V    F+ + NGVRIK++ +  +G A+NI FQ+  M NV NPIIIDQ+YC D + C  Q S V++ +V+Y++I GTSAT+V + L+CS K PC GI LE+VK+    +   ASC NA+    G + P
Sbjct:  231 VEITAPGDSPNTDGIHITNTQNIRVSNSDIGTGDDCISIEDGTQNLQIFDLTCGPGHGISIGSLGDDNSKAYVSGINVDGAKFSESDNGVRIKTY-QGGSGTAKNIKFQNIRMENVKNPIIIDQDYC-DKDKCEDQESAVQVKNVVYKNISGTSATDVAITLNCSEKYPCQGIVLENVKI----KGGTASCKNANVKNQGTVSP 428          
BLAST of CB250319 vs. ExPASy Swiss-Prot
Match: PGLR2_PLAAC (Exopolygalacturonase (Fragment) OS=Platanus acerifolia GN=plaa2 PE=1 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 5.502e-50
Identity = 100/209 (47.85%), Postives = 136/209 (65.07%), Query Frame = 2
Query:    2 QGVKVSAAGDSPNTDGIHVQASSGVTILDSKIGTGDDCVSVGPGATNLWIENVACGPGHGISIGSLGKEQQEAGVQNVTVTSVTFTGTQNGVRIKSWGRPSNGFARNILFQHALMNNVDNPIIIDQNYCPDNNNCPGQA-SGVKISDVIYQDIHGTSATEVGVKLDCSSKNPCTGISLEDVKLIYKNQ--PAEASCANADGSASGFILP 619
            Q V V+A G S NTDGIHV  S GVTI ++KI TGDDC+S+GPG+ N+ I  V CGPGHGISIGSLG+   E  V+ +TV   TF+GT NGVR+K+W     G A ++ FQ   MNNV NP+I+DQ YCP    C  QA S +K+S++ + +I GTS  +V V + CS   PC+ + + ++ L Y+    PA ++C+N   + SG  +P
Sbjct:  165 QHVTVTAPGTSINTDGIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVRGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCP-YGQCSRQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCSNVKPTFSGKQVP 372          
BLAST of CB250319 vs. ExPASy Swiss-Prot
Match: PGLR_OENOR (Exopolygalacturonase (Fragment) OS=Oenothera organensis PE=2 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.091e-49
Identity = 98/208 (47.12%), Postives = 131/208 (62.98%), Query Frame = 2
Query:   11 KVSAAGDSPNTDGIHVQASSGVTILDSKIGTGDDCVSVGPGATNLWIENVACGPGHGISIGSLGKEQQEAGVQNVTVTSVTFTGTQNGVRIKSWGRPSNGFARNILFQHALMNNVDNPIIIDQNYCPDNNNCPGQASGVKISDVIYQDIHGTSATEVGVKLDCSSKNPCTGISLEDVKLIY--KNQPAEASCANADGSASGFILPNSC 628
            K+SAA  S NTDGIH+  S GV I++++I TGDDC+S+G G+ N+ I N+ CGPGHGIS+GSLG+ + E  V  + V + T TG+QNGVRIK+W +   G A  + FQ   MN+V  PI+IDQ YCP N       S VK+S + +++I GTS T+  VKL CS   PC G+ L D+ L Y  K  PA + C N   +  G  +P  C
Sbjct:  147 KISAAETSINTDGIHIGRSDGVNIINTEIKTGDDCISLGDGSKNINITNITCGPGHGISVGSLGRYKNEESVVGIYVKNCTITGSQNGVRIKTWPKSEPGEASEMHFQDITMNSVGTPILIDQGYCPYNQCTAEVPSSVKLSKISFKNIKGTSTTKEAVKLVCSKSFPCNGVELADIDLTYSGKGGPATSVCENIKPTIKGKQIPAIC 354          
BLAST of CB250319 vs. ExPASy Swiss-Prot
Match: PGLR_ACTDE (Polygalacturonase OS=Actinidia deliciosa PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 2.731e-49
Identity = 99/204 (48.53%), Postives = 132/204 (64.71%), Query Frame = 2
Query:   14 VSAAGDSPNTDGIHVQASSGVTILDSKIGTGDDCVSVGPGATNLWIENVACGPGHGISIGSLGKEQQEAGVQNVTVTSVTFTGTQNGVRIKSWGRPSNGFARNILFQHALMNNVDNPIIIDQNYCPDNNNCPGQASGVKISDVIYQDIHGTSATEVGVKLDCSSKNPCTGISLEDVKL-IYKNQPAEASCANADGSASGFILPN 622
            V+A  +SPNTDGIHV  +  + I    IGTGDDC+S+  G+  + + ++ CGPGHGISIGSLG    EA V +V V      GT NGVRIK+W +  +G A NI FQ+  M+NV+NPIIIDQNYC  +  C  Q+S V++ +V+YQ+I GT A+ V +  DCS + PC GI LEDV L I     A+A C N + S +G + P+
Sbjct:  252 VTAPENSPNTDGIHVTGTQNIHISSCVIGTGDDCISIVNGSRKVRVNDITCGPGHGISIGSLGYGNSEAHVSDVVVNGAKLCGTTNGVRIKTW-QGGSGSASNIKFQNVEMHNVENPIIIDQNYCDQDKPCQEQSSAVQVKNVVYQNIKGTCASNVAITFDCSKRFPCQGIVLEDVDLEIEGGAAAKALCNNVELSETGVVSPH 454          
BLAST of CB250319 vs. ExPASy Swiss-Prot
Match: PGLR_SOLLC (Polygalacturonase-2 OS=Solanum lycopersicum GN=PG2 PE=1 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.355e-48
Identity = 95/204 (46.57%), Postives = 135/204 (66.18%), Query Frame = 2
Query:   14 VSAAGDSPNTDGIHVQASSGVTILDSKIGTGDDCVSVGPGATNLWIENVACGPGHGISIGSLGKEQQEAGVQNVTVTSVTFTGTQNGVRIKSWGRPSNGFARNILFQHALMNNVDNPIIIDQNYCPDNNNCPGQASGVKISDVIYQDIHGTSATEVGVKLDCSSKNPCTGISLEDVKLIYKN-QPAEASCANADGSASGFILPN 622
            ++A+  SPNTDG+HV  +  + I D+ IGTGDDC+S+  G+ N+   N+ CGPGHGISIGSLG    EA V NVTV      G +NGVRIK+W +  +G A NI F +  M +V  PIIIDQNYC     C  Q S V++ +V+Y++I GTSAT+V +K DCS+  PC GI +E++ L+ ++ +P+EA+C N   + +  + P+
Sbjct:  239 INASAKSPNTDGVHVSNTQYIQISDTIIGTGDDCISIVSGSQNVQATNITCGPGHGISIGSLGSGNSEAYVSNVTVNEAKIIGAENGVRIKTW-QGGSGQASNIKFLNVEMQDVKYPIIIDQNYCDRVEPCIQQFSAVQVKNVVYENIKGTSATKVAIKFDCSTNFPCEGIIMENINLVGESGKPSEATCKNVHFNNAEHVTPH 441          
BLAST of CB250319 vs. ExPASy Swiss-Prot
Match: ADPG2_ARATH (Polygalacturonase ADPG2 OS=Arabidopsis thaliana GN=ADPG2 PE=2 SV=2)

HSP 1 Score: 192.2 bits (487), Expect = 2.312e-48
Identity = 96/204 (47.06%), Postives = 136/204 (66.67%), Query Frame = 2
Query:    8 VKVSAAGDSPNTDGIHVQASSGVTILDSKIGTGDDCVSVGPGATNLWIENVACGPGHGISIGSLGKEQQEAGVQNVTVTSVTFTGTQNGVRIKSWGRPSNGFARNILFQHALMNNVDNPIIIDQNYCPDNNNCPGQASGVKISDVIYQDIHGTSATEVGVKLDCSSKNPCTGISLEDVKLIYKNQPAEASCANADGSASGFILP 619
            V V+A  DSPNTDGIH+  +  + + +S IGTGDDC+S+  G+ N+ I ++ CGPGHGISIGSLG +  +A V  VTV     +GT NGVRIK++ +  +G A NI+FQ+  M+NV NPIIIDQ+YC D + C  + S V++ +V+Y+DI GTSA+E  +  +CS   PC GI L+ V +    +  +A+C NA+    G +LP
Sbjct:  231 VVVTAPADSPNTDGIHITNTQNIRVSESIIGTGDDCISIESGSQNVQINDITCGPGHGISIGSLGDDNSKAFVSGVTVDGAKLSGTDNGVRIKTY-QGGSGTASNIIFQNIQMDNVKNPIIIDQDYC-DKSKCTTEKSAVQVKNVVYRDISGTSASENAITFNCSKNYPCQGIVLDRVNI----KGGKATCTNANVVDKGAVLP 428          
The following BLAST results are available for this feature:
BLAST of CB250319 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
PGLR_PRUPE1.478e-9577.62Polygalacturonase OS=Prunus persica PE=2 SV=1[more]
PGLR6_ARATH4.625e-7362.38Probable polygalacturonase At2g43860 OS=Arabidopsi... [more]
PGLR2_ARATH7.677e-5249.76Exopolygalacturonase clone GBGA483 OS=Arabidopsis ... [more]
QRT2_ARATH1.710e-5148.53Polygalacturonase QRT2 OS=Arabidopsis thaliana GN=... [more]
ADPG1_ARATH4.213e-5048.53Polygalacturonase ADPG1 OS=Arabidopsis thaliana GN... [more]
PGLR2_PLAAC5.502e-5047.85Exopolygalacturonase (Fragment) OS=Platanus acerif... [more]
PGLR_OENOR2.091e-4947.12Exopolygalacturonase (Fragment) OS=Oenothera organ... [more]
PGLR_ACTDE2.731e-4948.53Polygalacturonase OS=Actinidia deliciosa PE=2 SV=1[more]
PGLR_SOLLC1.355e-4846.57Polygalacturonase-2 OS=Solanum lycopersicum GN=PG2... [more]
ADPG2_ARATH2.312e-4847.06Polygalacturonase ADPG2 OS=Arabidopsis thaliana GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0106 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ154 similar to polygalacturonase (acc# AAC64184), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250319 ID=CB250319|Name=CB250319|organism=Citrus sinensis|type=EST|length=708bp
ACAGGGGGTCAAAGTTTCGGCCGCCGGTGACAGCCCAAACACCGATGGCA
TTCATGTTCAAGCATCAAGTGGTGTCACAATTTTGGACAGCAAAATTGGG
ACTGGTGATGATTGTGTATCAGTTGGACCTGGCGCCACCAACTTATGGAT
TGAAAATGTTGCTTGTGGCCCAGGCCATGGGATCAGCATTGGCAGCTTGG
GCAAAGAGCAACAAGAGGCTGGAGTGCAAAATGTGACAGTAACATCTGTG
ACATTTACAGGCACTCAAAATGGAGTGAGGATTAAGTCCTGGGGGAGACC
AAGCAATGGATTTGCCAGGAACATTCTTTTCCAACACGCTCTTATGAACA
ATGTCGATAATCCAATCATAATTGATCAAAATTACTGCCCTGACAACAAC
AATTGCCCTGGACAGGCTTCAGGGGTTAAAATCAGTGATGTGATATATCA
AGACATTCATGGAACTTCGGCAACGGAAGTTGGAGTAAAGCTCGATTGCA
GTTCGAAGAATCCATGCACTGGAATTAGCTTGGAGGATGTGAAGCTCATT
TACAAGAATCAACCAGCTGAAGCTTCCTGCGCCAACGCTGATGGATCGGC
CTCTGGATTTATTCTGCCAAATAGTTGCTTGAAGACTTGAAGTTATGAAA
AGTATTTGAGTTGGAAAAAAAAGGCATAGGAAGCCGATCATGATTATATA
GTTAGTAG
back to top