CB250322

Overview
NameCB250322
Unique NameCB250322
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length395
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2190 contig Csv1_Contig2190:1154..1548. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250322 vs. ExPASy Swiss-Prot
Match: FDFT_NICBE (Squalene synthetase OS=Nicotiana benthamiana PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 2.288e-44
Identity = 87/118 (73.73%), Postives = 98/118 (83.05%), Query Frame = 3
Query:    3 MSVLRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSGLRYSSTM 356
            MS LRD +IFRFCAIPQ+MAIGTLA+CY+NIEVFRGVVKMRRGLTAKVIDRT  + DVY AF+DFS +LK K+N NDPNATKTL R+E I K C DSG LNKRKSYII+S   YS  +
Sbjct:  274 MSALRDPSIFRFCAIPQVMAIGTLAMCYDNIEVFRGVVKMRRGLTAKVIDRTRTIADVYGAFFDFSCMLKSKVNNNDPNATKTLKRLEVILKTCRDSGTLNKRKSYIIRSEPNYSPVL 391          
BLAST of CB250322 vs. ExPASy Swiss-Prot
Match: FDFT_ARATH (Squalene synthetase OS=Arabidopsis thaliana GN=SQS1 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.063e-41
Identity = 82/111 (73.87%), Postives = 94/111 (84.68%), Query Frame = 3
Query:    3 MSVLRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKRKSYIIQSG 335
            M  LRD +IFRFCAIPQIMAIGTLALCYNN +VFRGVVK+RRGLTAKVIDRT  M DVY AFYDFS +LK K++KNDPNA+KTL+R+EA+QK C D+GVL  RKSY+   G
Sbjct:  276 MVSLRDPSIFRFCAIPQIMAIGTLALCYNNEQVFRGVVKLRRGLTAKVIDRTKTMADVYGAFYDFSCMLKTKVDKNDPNASKTLNRLEAVQKLCRDAGVLQNRKSYVNDKG 386          
BLAST of CB250322 vs. ExPASy Swiss-Prot
Match: FDFT_DICDI (Squalene synthetase OS=Dictyostelium discoideum GN=fdfT PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.764e-20
Identity = 45/98 (45.92%), Postives = 68/98 (69.39%), Query Frame = 3
Query:    3 MSVLRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVID--RTNNMTDVYLAFYDFSNILKPKINKNDPNATKTLSRVEAIQKACMD 290
            MS L++  +  FCAIPQ+MAIGTL  CYNN  VF GVVK+R+G  A ++D  ++  +T  Y  F+ F+N ++ K+  NDP+A KT+  +E+I+K C++
Sbjct:  277 MSRLKNPQVINFCAIPQVMAIGTLNACYNNYNVFTGVVKIRKGQRALIVDAIQSKGLTATYELFFKFANEMRHKVPPNDPSAKKTIQHLESIEKLCIE 374          
BLAST of CB250322 vs. ExPASy Swiss-Prot
Match: FDFT_MOUSE (Squalene synthetase OS=Mus musculus GN=Fdft1 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.308e-15
Identity = 41/106 (38.68%), Postives = 63/106 (59.43%), Query Frame = 3
Query:    3 MSVLRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKRKSY 320
            +S LR+ ++F FCAIPQ+MAI TLA CYNN +VF+GVVK+R+G    ++    NM  V    Y +   +  +I  +DP+++KT   +  I+   + +  L  R  Y
Sbjct:  277 LSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGVVKIRKGQAVTLMMDATNMPAVKAIIYQYIEEIYHRIPNSDPSSSKTKQVISKIRTQNLPNCQLISRSHY 382          
BLAST of CB250322 vs. ExPASy Swiss-Prot
Match: FDFT_RAT (Squalene synthetase OS=Rattus norvegicus GN=Fdft1 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.709e-15
Identity = 40/106 (37.74%), Postives = 62/106 (58.49%), Query Frame = 3
Query:    3 MSVLRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKRKSY 320
            +S LR+ ++F FCAIPQ+MAI TLA CYNN +VF+GVVK+R+G    ++    NM  V    Y +   +  ++  +DP+A+K    +  I+   + +  L  R  Y
Sbjct:  277 LSRLRNQSVFNFCAIPQVMAIATLAACYNNHQVFKGVVKIRKGQAVTLMMDATNMPAVKAIIYQYIEEIYHRVPNSDPSASKAKQLISNIRTQSLPNCQLISRSHY 382          
BLAST of CB250322 vs. ExPASy Swiss-Prot
Match: FDFT_BOVIN (Squalene synthetase OS=Bos taurus GN=FDFT1 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.232e-15
Identity = 42/106 (39.62%), Postives = 62/106 (58.49%), Query Frame = 3
Query:    3 MSVLRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKRKSY 320
            +S LR+ +IF FCAIPQ+MAI TLA CYNN +VF+GVVK+R+G    ++    NM  V    + +   +  +I  +DP +TKT   +  I+   + +  L  R  Y
Sbjct:  277 LSRLRNQSIFNFCAIPQVMAIATLAACYNNQQVFKGVVKIRKGQAVTLMMDATNMPAVKAIIHQYMEEIYHRIPNSDPCSTKTQQIISTIRTQNLPNCQLVSRSHY 382          
BLAST of CB250322 vs. ExPASy Swiss-Prot
Match: FDFT_PONAB (Squalene synthetase OS=Pongo abelii GN=FDFT1 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.915e-15
Identity = 40/106 (37.74%), Postives = 62/106 (58.49%), Query Frame = 3
Query:    3 MSVLRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKRKSY 320
            +S LR+ ++F FCAIPQ+MAI TLA CYNN +VF+G VK+R+G    ++    NM  V    Y +   +  +I  +DP+++KT   +  I+   + +  L  R  Y
Sbjct:  277 LSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTRQIISTIRTQNLPNCQLISRSHY 382          
BLAST of CB250322 vs. ExPASy Swiss-Prot
Match: FDFT_HUMAN (Squalene synthetase OS=Homo sapiens GN=FDFT1 PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.915e-15
Identity = 40/106 (37.74%), Postives = 62/106 (58.49%), Query Frame = 3
Query:    3 MSVLRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINKNDPNATKTLSRVEAIQKACMDSGVLNKRKSY 320
            +S LR+ ++F FCAIPQ+MAI TLA CYNN +VF+G VK+R+G    ++    NM  V    Y +   +  +I  +DP+++KT   +  I+   + +  L  R  Y
Sbjct:  277 LSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTRQIISTIRTQNLPNCQLISRSHY 382          
BLAST of CB250322 vs. ExPASy Swiss-Prot
Match: FDFT_USTMA (Squalene synthetase OS=Ustilago maydis GN=ERG9 PE=3 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 2.728e-13
Identity = 35/94 (37.23%), Postives = 59/94 (62.77%), Query Frame = 3
Query:    3 MSVLRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINKNDPNATKTLSRVEAIQKAC 284
            +++L++ ++F FCAIPQ+MAI TL L +NN +VF+  VK+R+G+   +I R  N  DV   F  +S  +  +++  DPN T+    +  I++ C
Sbjct:  309 LALLKEQSVFNFCAIPQVMAIATLELMFNNPDVFKKNVKIRKGVAVGLILRAVNPRDVAYTFLHYSRKMHARLSPADPNFTRWSVELARIEQWC 402          
BLAST of CB250322 vs. ExPASy Swiss-Prot
Match: FDFT_CANAL (Squalene synthetase OS=Candida albicans GN=ERG9 PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.078e-13
Identity = 35/94 (37.23%), Postives = 57/94 (60.64%), Query Frame = 3
Query:    3 MSVLRDHAIFRFCAIPQIMAIGTLALCYNNIEVFRGVVKMRRGLTAKVIDRTNNMTDVYLAFYDFSNILKPKINKNDPNATKTLSRVEAIQKAC 284
            +S+++D + F FCAIPQ+MA+ TLA  YNN +V  GVVK+R+G T ++I  +  +  V   F ++  ++  K +  DPN  K   +   I++ C
Sbjct:  288 LSLVKDPSSFSFCAIPQVMAVATLAEVYNNPKVLHGVVKIRKGTTCRLILESRTLPGVVKIFKEYIQVINHKSSVRDPNYLKIGIKCGEIEQYC 381          
The following BLAST results are available for this feature:
BLAST of CB250322 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
FDFT_NICBE2.288e-4473.73Squalene synthetase OS=Nicotiana benthamiana PE=2 ... [more]
FDFT_ARATH1.063e-4173.87Squalene synthetase OS=Arabidopsis thaliana GN=SQS... [more]
FDFT_DICDI1.764e-2045.92Squalene synthetase OS=Dictyostelium discoideum GN... [more]
FDFT_MOUSE1.308e-1538.68Squalene synthetase OS=Mus musculus GN=Fdft1 PE=2 ... [more]
FDFT_RAT1.709e-1537.74Squalene synthetase OS=Rattus norvegicus GN=Fdft1 ... [more]
FDFT_BOVIN2.232e-1539.62Squalene synthetase OS=Bos taurus GN=FDFT1 PE=2 SV... [more]
FDFT_PONAB2.915e-1537.74Squalene synthetase OS=Pongo abelii GN=FDFT1 PE=2 ... [more]
FDFT_HUMAN2.915e-1537.74Squalene synthetase OS=Homo sapiens GN=FDFT1 PE=1 ... [more]
FDFT_USTMA2.728e-1337.23Squalene synthetase OS=Ustilago maydis GN=ERG9 PE=... [more]
FDFT_CANAL6.078e-1337.23Squalene synthetase OS=Candida albicans GN=ERG9 PE... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0109 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ158 similar to farnesyl-diphosphate farnesyltransferase (acc# T05262), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250322 ID=CB250322|Name=CB250322|organism=Citrus sinensis|type=EST|length=395bp
ACATGTCTGTTTTAAGGGATCATGCTATATTCCGATTCTGTGCTATCCCT
CAGATCATGGCTATTGGAACACTAGCATTATGCTACAACAATATTGAAGT
CTTCAGAGGTGTAGTCAAAATGAGGCGTGGACTCACCGCTAAAGTCATTG
ACCGAACAAACAACATGACTGATGTCTATCTTGCCTTCTATGATTTTTCC
AATATTCTGAAACCCAAGATTAACAAGAATGATCCAAATGCGACAAAAAC
ATTGAGCAGGGTGGAAGCAATACAGAAAGCTTGCATGGACTCCGGAGTCC
TAAACAAAAGAAAATCTTACATTATTCAAAGTGGGCTGCGATATAGTTCA
ACCATGATTGTCATATTTTTCATCATACTGGCCATTATTTTCTCG
back to top