CB250323

Overview
NameCB250323
Unique NameCB250323
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length509
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6985 contig Csv1_Contig6985:646..1154. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250323 vs. ExPASy Swiss-Prot
Match: OPR2_ARATH (12-oxophytodienoate reductase 2 OS=Arabidopsis thaliana GN=OPR2 PE=2 SV=2)

HSP 1 Score: 293.123 bits (749), Expect = 4.811e-79
Identity = 135/169 (79.88%), Postives = 157/169 (92.90%), Query Frame = 1
Query:    1 TDKPLTPQIRANGVDIAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGYLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTVGEKSECPHSLLPMRKAFK 507
            T KP+ PQ+RANG+D A+FTPPRRL  +EIP IVNDFRLAARNA+EAGFDG+E+HGAHGYLIDQFMKD+VNDRTD+YGGSL+NRC+FALE+V+AV+ EIG DRVGIRLSPFA+YMESGD+NPEALGLYM ESLNKYGILYCHM+EPRMKTVGE + C H+L+PMR+AFK
Sbjct:  131 TGKPIMPQMRANGIDEARFTPPRRLSIEEIPGIVNDFRLAARNAMEAGFDGVEIHGAHGYLIDQFMKDKVNDRTDEYGGSLQNRCKFALEVVDAVAKEIGPDRVGIRLSPFADYMESGDTNPEALGLYMVESLNKYGILYCHMIEPRMKTVGEIAACSHTLMPMREAFK 299          
BLAST of CB250323 vs. ExPASy Swiss-Prot
Match: OPR1_SOLLC (12-oxophytodienoate reductase 1 OS=Solanum lycopersicum GN=OPR1 PE=1 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 9.074e-78
Identity = 136/169 (80.47%), Postives = 155/169 (91.72%), Query Frame = 1
Query:    1 TDKPLTPQIRANGVDIAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGYLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTVGEKSECPHSLLPMRKAFK 507
            TD+ LTPQIR+NG+DIA FT PRRL TDEIPQIVN+FR+AARNAIEAGFDG+E+HGAHGYLIDQFMKDQVNDR+D+YGGSLENRCRFALEIVEAV+NEIG+DRVGIR+SPFA+Y E+GD+NP ALGLYM ESLNKY + YCH+VEPRMKT  EK EC  SL+PMRKA+K
Sbjct:  133 TDRGLTPQIRSNGIDIAHFTRPRRLTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFALEIVEAVANEIGSDRVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYCHVVEPRMKTAWEKIECTESLVPMRKAYK 301          
BLAST of CB250323 vs. ExPASy Swiss-Prot
Match: OPR1_ARATH (12-oxophytodienoate reductase 1 OS=Arabidopsis thaliana GN=OPR1 PE=1 SV=2)

HSP 1 Score: 285.804 bits (730), Expect = 7.681e-77
Identity = 134/169 (79.29%), Postives = 154/169 (91.12%), Query Frame = 1
Query:    1 TDKPLTPQIRANGVDIAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGYLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTVGEKSECPHSLLPMRKAFK 507
            +DKPL PQIR+NG+D A FTPPRRL  +EIP IVNDFRLAARNA+EAGFDG+E+HGA+GYLIDQFMKD VNDRTD+YGGSL+NRC+F LEIV+AV+ EIG DRVGIRLSPFA+YMESGD+NP ALGLYMAESLNKYGILYCH++E RMKT+GE   CPH+L+PMRKAFK
Sbjct:  129 SDKPLMPQIRSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDTVNDRTDEYGGSLQNRCKFPLEIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYMAESLNKYGILYCHVIEARMKTMGEVHACPHTLMPMRKAFK 297          
BLAST of CB250323 vs. ExPASy Swiss-Prot
Match: OPRL1_ARATH (Putative 12-oxophytodienoate reductase-like protein 1 OS=Arabidopsis thaliana GN=At1g09400 PE=2 SV=2)

HSP 1 Score: 259.225 bits (661), Expect = 7.699e-69
Identity = 121/151 (80.13%), Postives = 136/151 (90.07%), Query Frame = 1
Query:   52 QFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGYLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTVGEKSECPHSLLPMRKAF 504
            +FTPPRRLRTDEIP I+NDFRLAARNA EAGFDG+E+HGAHGYLIDQFMKD VNDRTD YGGSLENRCRFAL+++EAVS EIG DRVGIRLSPFA+YMESGD++P+ LGLYMA+SLN++ ILYCHM+EPRMKTV E  EC  SL PMR AF
Sbjct:  123 EFTPPRRLRTDEIPTIINDFRLAARNATEAGFDGVEIHGAHGYLIDQFMKDSVNDRTDSYGGSLENRCRFALQVIEAVSKEIGPDRVGIRLSPFADYMESGDTDPKRLGLYMAKSLNRFEILYCHMIEPRMKTVSEIFECRESLTPMRNAF 273          
BLAST of CB250323 vs. ExPASy Swiss-Prot
Match: OPRL2_ARATH (Putative 12-oxophytodienoate reductase-like protein 2 OS=Arabidopsis thaliana GN=At1g17990 PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 1.779e-57
Identity = 105/138 (76.09%), Postives = 124/138 (89.86%), Query Frame = 1
Query:    1 TDKPLTPQIRANGVDIAQFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGYLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGI 414
            TDKPL  +    G    QF PPRRLR+DE+P IVNDFR+AARNAIEAGFDG+E+HGAHGYLIDQF+KD+VNDR+DQYGGSLENRCRFALE++EAV NEIG+DRVGIRLSPFA+YMESGDSNPEALGLY+ +++NK+G+
Sbjct:  125 TDKPLMCKNMYGG----QFKPPRRLRSDELPAIVNDFRIAARNAIEAGFDGVEVHGAHGYLIDQFLKDKVNDRSDQYGGSLENRCRFALEVIEAVVNEIGSDRVGIRLSPFADYMESGDSNPEALGLYLVQAMNKHGM 258          
BLAST of CB250323 vs. ExPASy Swiss-Prot
Match: OPRL_SOLLC (12-oxophytodienoate reductase-like protein OS=Solanum lycopersicum GN=OPR2 PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.159e-40
Identity = 90/149 (60.40%), Postives = 113/149 (75.84%), Query Frame = 1
Query:   64 PRRLRTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHG-YLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKYGILYCHMVEPRMKTVGEKSECPHSLLPMRKAFK 507
            P  L +D+IP IVNDFR+AARNAI+AGFDGIE++ + G YLID+FM DQV+  TD+Y  S+++RCR ALEIVEAV+NEIGAD++GI+LSPF       DSN EAL  YMA  L+K G+LY H++EPR +TV        SLLP+RKAFK
Sbjct:  142 PLPLESDKIPCIVNDFRIAARNAIKAGFDGIEINASSGGYLIDEFMNDQVHGWTDEYDESIKDRCRLALEIVEAVANEIGADKIGIKLSPFDG---KKDSNSEALATYMANELSKLGVLYLHVMEPR-ETVN------RSLLPIRKAFK 280          
BLAST of CB250323 vs. ExPASy Swiss-Prot
Match: OPR3_SOLLC (12-oxophytodienoate reductase 3 OS=Solanum lycopersicum GN=OPR3 PE=1 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 7.509e-40
Identity = 82/161 (50.93%), Postives = 113/161 (70.19%), Query Frame = 1
Query:    1 TDKPLTPQIRANGVDIAQ--FTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGYLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKY------GILYCHMVEPRMKTVGE 459
            T+KP++ + R    D     +  PR + T EI Q+V D+R +A NAIEAGFDGIE+HGAHGYLIDQF+KD +NDRTD+YGGSL NRC+F  ++V+AV + IGADRVG+R+SP  +++++ DSNP +LGL + E LNK        + Y H+ +PR    G+
Sbjct:  129 TEKPISNRWRILMPDGTHGIYPKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFITQVVQAVVSAIGADRVGVRVSPAIDHLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRYVAYGQ 289          
BLAST of CB250323 vs. ExPASy Swiss-Prot
Match: OPR3_ARATH (12-oxophytodienoate reductase 3 OS=Arabidopsis thaliana GN=OPR3 PE=1 SV=2)

HSP 1 Score: 155.221 bits (391), Expect = 1.566e-37
Identity = 73/142 (51.41%), Postives = 101/142 (71.13%), Query Frame = 1
Query:   52 QFTPPRRLRTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGYLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDSNPEALGLYMAESLNKY------GILYCHMVEPRMKTVGE 459
            ++  PR L   EIP++V D+ L+A NAI AGFDGIE+HGAHGYLIDQF+KD +NDRTDQYGGS+ NRCRF  ++VE V + IGA +VG+R+SP  +++++ DS+P +LGL +   LNK        + Y H+ +PR    G+
Sbjct:  149 KYPKPRALEASEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGGSIANRCRFLKQVVEGVVSAIGASKVGVRVSPAIDHLDATDSDPLSLGLAVVGMLNKLQGVNGSKLAYLHVTQPRYHAYGQ 290          
BLAST of CB250323 vs. ExPASy Swiss-Prot
Match: NEMA_ECOLI (N-ethylmaleimide reductase OS=Escherichia coli (strain K12) GN=nemA PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.792e-33
Identity = 72/126 (57.14%), Postives = 85/126 (67.46%), Query Frame = 1
Query:   64 PRRLRTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGYLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFANYMESGDS-NPEALGLYMAESLNKYGILYCHMVEP 438
            PR L  +EIP IVNDFR A  NA EAGFD +ELH AHGYL+ QF+    N RTDQYGGS+ENR R  LE+V+A   E GADR+GIR+SP   +  + +  N EA  LY+ E L K GI Y HM EP
Sbjct:  149 PRALELEEIPGIVNDFRQAIANAREAGFDLVELHSAHGYLLHQFLSPSSNHRTDQYGGSVENRARLVLEVVDAGIEEWGADRIGIRVSPIGTFQNTDNGPNEEADALYLIEQLGKRGIAYLHMSEP 274          
BLAST of CB250323 vs. ExPASy Swiss-Prot
Match: OYE1_SACPS (NADPH dehydrogenase 1 OS=Saccharomyces pastorianus GN=OYE1 PE=1 SV=3)

HSP 1 Score: 114.005 bits (284), Expect = 4.000e-25
Identity = 60/136 (44.12%), Postives = 87/136 (63.97%), Query Frame = 1
Query:   61 PPRRLRTDEIPQIVNDFRLAARNAIEAGFDGIELHGAHGYLIDQFMKDQVNDRTDQYGGSLENRCRFALEIVEAVSNEIGADRVGIRLSPFA--NYMESG-DSNPEALGLYMAESLNKYG-----ILYCHMVEPRM 444
            P   L  DEI Q + ++  AA+N+I AG DG+E+H A+GYL++QF+    N RTD+YGGS+ENR RF LE+V+A+   IG ++VG+RLSP+   N M  G ++   A   Y+A  L K       + + H+VEPR+
Sbjct:  158 PQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRV 293          
The following BLAST results are available for this feature:
BLAST of CB250323 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
OPR2_ARATH4.811e-7979.8812-oxophytodienoate reductase 2 OS=Arabidopsis tha... [more]
OPR1_SOLLC9.074e-7880.4712-oxophytodienoate reductase 1 OS=Solanum lycoper... [more]
OPR1_ARATH7.681e-7779.2912-oxophytodienoate reductase 1 OS=Arabidopsis tha... [more]
OPRL1_ARATH7.699e-6980.13Putative 12-oxophytodienoate reductase-like protei... [more]
OPRL2_ARATH1.779e-5776.09Putative 12-oxophytodienoate reductase-like protei... [more]
OPRL_SOLLC1.159e-4060.4012-oxophytodienoate reductase-like protein OS=Sola... [more]
OPR3_SOLLC7.509e-4050.9312-oxophytodienoate reductase 3 OS=Solanum lycoper... [more]
OPR3_ARATH1.566e-3751.4112-oxophytodienoate reductase 3 OS=Arabidopsis tha... [more]
NEMA_ECOLI1.792e-3357.14N-ethylmaleimide reductase OS=Escherichia coli (st... [more]
OYE1_SACPS4.000e-2544.12NADPH dehydrogenase 1 OS=Saccharomyces pastorianus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0110 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ159 similar to 12-phytodienoate reductase OPR2 (acc# NP_177795), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250323 ID=CB250323|Name=CB250323|organism=Citrus sinensis|type=EST|length=509bp
ACAGACAAGCCATTGACCCCTCAAATCCGCGCTAATGGTGTTGATATTGC
ACAATTCACTCCTCCAAGGCGGCTAAGGACAGATGAAATCCCTCAAATTG
TGAATGATTTCAGGCTTGCTGCAAGAAACGCAATTGAGGCTGGTTTTGAT
GGCATTGAGCTCCACGGTGCACATGGCTACCTAATTGACCAATTTATGAA
GGATCAAGTGAATGATCGAACAGACCAGTATGGAGGATCCTTAGAGAATC
GTTGCCGTTTTGCTTTAGAAATAGTTGAAGCTGTTTCCAATGAAATAGGG
GCAGATAGGGTTGGGATAAGACTATCTCCGTTTGCAAACTATATGGAATC
AGGAGACTCTAACCCAGAAGCTTTAGGTCTTTACATGGCAGAATCCTTGA
ACAAATATGGTATCCTCTATTGTCACATGGTTGAGCCAAGGATGAAAACA
GTTGGAGAAAAATCTGAATGTCCTCACAGTTTGCTGCCCATGAGGAAGGC
TTTCAAGGG
back to top