CB250334

Overview
NameCB250334
Unique NameCB250334
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length321
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13083 contig Csv1_Contig13083:366..686. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250334 vs. ExPASy Swiss-Prot
Match: TI10A_ARATH (Protein TIFY 10A OS=Arabidopsis thaliana GN=TIFY10A PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.529e-13
Identity = 48/111 (43.24%), Postives = 62/111 (55.86%), Query Frame = 2
Query:   17 RPAATTMNLFPVS----DNSGQDVSARNMAAPRNWESMNLFPQQAGFA------PKNDTPNMIDSSLN-KPAPQTAQMTIFYGGQVIVFNDFPADKANEIMQLASNGSSLS 316
            R   TTM+LFP      D+  QDV           +  NLFP+Q  F+      PK D   M  ++ + KP  QTA +TIFY GQVIVFNDF A+KA E++ LAS G++ S
Sbjct:   61 RQPTTTMSLFPCEASNMDSMVQDV-----------KPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTANS 160          
BLAST of CB250334 vs. ExPASy Swiss-Prot
Match: TI10B_ARATH (Protein TIFY 10B OS=Arabidopsis thaliana GN=TIFY10B PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 5.634e-11
Identity = 40/103 (38.83%), Postives = 60/103 (58.25%), Query Frame = 2
Query:   29 TTMNLFPVSDNSGQDVSARNMAAPRNWESMNLFPQQAGFAPKNDTPNMIDSSLNK-------PAPQTAQMTIFYGGQVIVFNDFPADKANEIMQLASNGSSLS 316
            T MNLFP  + SG D SA       + +   +FP+Q+ F+  + +    D  + K       P  Q+A +TIFYGG+V+VF+DF A+KA E++ LA+ GS+ S
Sbjct:   56 TMMNLFPC-EASGMDSSA----GQEDIKPKTMFPRQSSFSSSSSSGTKEDVQMIKETTKSVKPESQSAPLTIFYGGRVMVFDDFSAEKAKEVIDLANKGSAKS 153          
The following BLAST results are available for this feature:
BLAST of CB250334 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
TI10A_ARATH3.529e-1343.24Protein TIFY 10A OS=Arabidopsis thaliana GN=TIFY10... [more]
TI10B_ARATH5.634e-1138.83Protein TIFY 10B OS=Arabidopsis thaliana GN=TIFY10... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0123 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ180 similar to unknown Oryza protein (acc# BAC16504), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250334 ID=CB250334|Name=CB250334|organism=Citrus sinensis|type=EST|length=321bp
ACCCGAGATCCCGCGGCGGCCAGCAGCTACAACTATGAATTTGTTTCCAG
TAAGTGACAACTCTGGACAAGATGTTTCAGCTCGAAACATGGCAGCTCCT
CGAAACTGGGAATCAATGAATTTGTTCCCTCAACAAGCTGGTTTTGCTCC
TAAGAATGATACCCCTAACATGATAGATTCAAGTTTAAACAAGCCCGCTC
CGCAAACTGCTCAAATGACTATATTTTATGGCGGACAAGTGATTGTGTTC
AATGATTTTCCTGCTGATAAAGCAAATGAAATCATGCAATTAGCAAGCAA
CGGGAGCTCACTGAGCCATGG
back to top