CB250353

Overview
NameCB250353
Unique NameCB250353
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length367
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB250353_ssr326 microsatellite CB250353_ssr326:326..337. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig11819 contig Csv1_Contig11819:228..594. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250353 vs. ExPASy Swiss-Prot
Match: C71BQ_ARATH (Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 2.162e-26
Identity = 58/98 (59.18%), Postives = 72/98 (73.47%), Query Frame = 3
Query:    3 WESPEEFIPERFIDKPVDVKGQDFEYLPFGSGRRICPGINLGLIMSELALANLLYCFDWKLPNGREEDCVNMNMEEATGVSLTLSKKTPLILVPVNYL 296
            W+ PE F+PERF D  +D KGQ+FE L FGSGRRICPG+ +G  M E  LAN+LY FDWKLP G   +  +++MEEA G  LT+SKK+ L+LVPV YL
Sbjct:  405 WKDPEMFLPERFNDSNIDAKGQNFELLSFGSGRRICPGLYMGTTMVEFGLANMLYHFDWKLPEGMVVE--DIDMEEAPG--LTVSKKSELVLVPVKYL 498          
BLAST of CB250353 vs. ExPASy Swiss-Prot
Match: C71BV_ARATH (Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.073e-25
Identity = 56/98 (57.14%), Postives = 69/98 (70.41%), Query Frame = 3
Query:    3 WESPEEFIPERFIDKPVDVKGQDFEYLPFGSGRRICPGINLGLIMSELALANLLYCFDWKLPNGREEDCVNMNMEEATGVSLTLSKKTPLILVPVNYL 296
            W+ PE F+PERF D  +D KGQ FE LPFG GRR+CP + +G  M E  LANLLY FDWKLP G + D  +++MEEA G  LT++KK  LILVP  +L
Sbjct:  405 WKDPEVFLPERFTDNNIDAKGQHFELLPFGGGRRMCPAVYMGTTMVEFGLANLLYHFDWKLPEGMKVD--DIDMEEAPG--LTVNKKNELILVPTKFL 498          
BLAST of CB250353 vs. ExPASy Swiss-Prot
Match: C71BA_ARATH (Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.390e-25
Identity = 57/98 (58.16%), Postives = 71/98 (72.45%), Query Frame = 3
Query:    3 WESPEEFIPERFIDKPVDVKGQDFEYLPFGSGRRICPGINLGLIMSELALANLLYCFDWKLPNGREEDCVNMNMEEATGVSLTLSKKTPLILVPVNYL 296
            W+ PEEF+PERF+D  +DVKGQD+E LPFGSGRRICP + +G+   E  LANLLY FDWKLP G   +  ++ M+EA+G  LT  KK  L+LVPV  L
Sbjct:  408 WKDPEEFLPERFMDCDIDVKGQDYELLPFGSGRRICPAVYMGITTVEFGLANLLYHFDWKLPEGVAVE--DIYMDEASG--LTSHKKHDLLLVPVKSL 501          
BLAST of CB250353 vs. ExPASy Swiss-Prot
Match: C71BZ_ARATH (Cytochrome P450 71B38 OS=Arabidopsis thaliana GN=CYP71B38 PE=2 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 3.122e-25
Identity = 51/97 (52.58%), Postives = 67/97 (69.07%), Query Frame = 3
Query:    3 WESPEEFIPERFIDKPVDVKGQDFEYLPFGSGRRICPGINLGLIMSELALANLLYCFDWKLPNGREEDCVNMNMEEATGVSLTLSKKTPLILVPVNY 293
            W+ P EFIPERF+D P+D KGQ FE LPFG+GRRICPG+  G+ M EL L NLLY FDW LPNG   + ++M  +E       ++KK PL+L+  ++
Sbjct:  406 WKQPGEFIPERFLDSPIDYKGQHFELLPFGAGRRICPGMATGITMVELGLLNLLYFFDWSLPNGMTIEDIDMEEDE----GFAIAKKVPLVLIQTSH 498          
BLAST of CB250353 vs. ExPASy Swiss-Prot
Match: C71BY_ARATH (Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=2 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 3.122e-25
Identity = 55/98 (56.12%), Postives = 70/98 (71.43%), Query Frame = 3
Query:    3 WESPEEFIPERFIDKPVDVKGQDFEYLPFGSGRRICPGINLGLIMSELALANLLYCFDWKLPNGREEDCVNMNMEEATGVSLTLSKKTPLILVPVNYL 296
            W+ PEEF+PERF++  +D KGQ+FE LPFGSGRR+CP + +G  M E  LANLLY FDWKLP G   +  +++MEE+ G  L  SKK  L+LVP  YL
Sbjct:  405 WKDPEEFLPERFVNSNIDAKGQNFELLPFGSGRRMCPAMYMGTTMVEFGLANLLYHFDWKLPEGMVVE--DIDMEESPG--LNASKKNELVLVPRKYL 498          
BLAST of CB250353 vs. ExPASy Swiss-Prot
Match: C71BP_ARATH (Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.077e-25
Identity = 58/97 (59.79%), Postives = 68/97 (70.10%), Query Frame = 3
Query:    3 WESPEEFIPERFIDKPVDVKGQDFEYLPFGSGRRICPGINLGLIMSELALANLLYCFDWKLPNGREEDCVNMNMEEATGVSLTLSKKTPLILVPVNY 293
            W++PEEF PERFID PVD KG  FE+LPFGSGRR CPG+   +   EL L NLLY FDWKLP    E+  +MNMEE+  V  T+ KK PL L+PV Y
Sbjct:  410 WKNPEEFNPERFIDCPVDYKGHSFEFLPFGSGRRFCPGMASAIATIELTLLNLLYFFDWKLP----EEMKDMNMEESGDV--TIVKKVPLELLPVLY 500          
BLAST of CB250353 vs. ExPASy Swiss-Prot
Match: C71BB_ARATH (Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 9.084e-25
Identity = 53/95 (55.79%), Postives = 69/95 (72.63%), Query Frame = 3
Query:    3 WESPEEFIPERFIDKPVDVKGQDFEYLPFGSGRRICPGINLGLIMSELALANLLYCFDWKLPNGREEDCVNMNMEEATGVSLTLSKKTPLILVPV 287
            W+ PE FIPERF+D  +D KG +FE+LPFGSGRR+CPGI +G+ +  L L NLLY FDWKLP G E +  ++++EE+ G  L   KK PL L+PV
Sbjct:  401 WKDPEAFIPERFMDNQIDYKGLNFEFLPFGSGRRMCPGIGMGMALVHLTLINLLYRFDWKLPEGMEVE--DVDLEESYG--LVCPKKVPLQLIPV 491          
BLAST of CB250353 vs. ExPASy Swiss-Prot
Match: C71BD_ARATH (Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 1.186e-24
Identity = 54/95 (56.84%), Postives = 68/95 (71.58%), Query Frame = 3
Query:    3 WESPEEFIPERFIDKPVDVKGQDFEYLPFGSGRRICPGINLGLIMSELALANLLYCFDWKLPNGREEDCVNMNMEEATGVSLTLSKKTPLILVPV 287
            W+ PE FIPERF+D  +D KG +FE LPFGSGRRICPGI +G+ +  L L NLLY FDWKLP G E +  ++++EE+ G  L   KK PL L+PV
Sbjct:  401 WKDPEAFIPERFMDNQIDYKGLNFELLPFGSGRRICPGIGMGMALIHLTLINLLYRFDWKLPEGMEVE--DVDLEESYG--LVCPKKVPLELIPV 491          
BLAST of CB250353 vs. ExPASy Swiss-Prot
Match: C71BX_ARATH (Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.549e-24
Identity = 52/98 (53.06%), Postives = 70/98 (71.43%), Query Frame = 3
Query:    3 WESPEEFIPERFIDKPVDVKGQDFEYLPFGSGRRICPGINLGLIMSELALANLLYCFDWKLPNGREEDCVNMNMEEATGVSLTLSKKTPLILVPVNYL 296
            W+ PEEF+PERF++  +D KGQ FE LPFGSGRR+CP + +G  M E  LAN+LY FDWK+P G   +  ++++EE+ G  L  SKK  L+LVP+ YL
Sbjct:  405 WKDPEEFLPERFVNSSIDAKGQHFELLPFGSGRRMCPAMYMGTTMVEFGLANMLYHFDWKIPVGMVAE--DIDLEESPG--LNASKKNELVLVPLKYL 498          
BLAST of CB250353 vs. ExPASy Swiss-Prot
Match: C71BL_ARATH (Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.549e-24
Identity = 54/95 (56.84%), Postives = 66/95 (69.47%), Query Frame = 3
Query:    3 WESPEEFIPERFIDKPVDVKGQDFEYLPFGSGRRICPGINLGLIMSELALANLLYCFDWKLPNGREEDCVNMNMEEATGVSLTLSKKTPLILVPV 287
            W +P EFIPERF+D P+D KGQ FE LPFG GRRICPG+  G+ + EL L N+LY FDW LP G      ++NMEEA   +  ++KK PL LVPV
Sbjct:  406 WTNPNEFIPERFVDSPIDYKGQHFELLPFGGGRRICPGMATGMTIVELGLLNVLYFFDWSLPYGMA--IADINMEEAG--AFVIAKKVPLELVPV 496          
The following BLAST results are available for this feature:
BLAST of CB250353 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 125
Match NameE-valueIdentityDescription
C71BQ_ARATH2.162e-2659.18Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=C... [more]
C71BV_ARATH1.073e-2557.14Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=C... [more]
C71BA_ARATH2.390e-2558.16Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=C... [more]
C71BZ_ARATH3.122e-2552.58Cytochrome P450 71B38 OS=Arabidopsis thaliana GN=C... [more]
C71BY_ARATH3.122e-2556.12Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=C... [more]
C71BP_ARATH4.077e-2559.79Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=C... [more]
C71BB_ARATH9.084e-2555.79Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=C... [more]
C71BD_ARATH1.186e-2456.84Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=C... [more]
C71BX_ARATH1.549e-2453.06Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=C... [more]
C71BL_ARATH1.549e-2456.84Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0147 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ214 similar to cytochrome P450 (acc # AAL24049), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250353 ID=CB250353|Name=CB250353|organism=Citrus sinensis|type=EST|length=367bp
ACTGGGAGAGTCCTGAAGAATTCATCCCAGAAAGGTTTATTGATAAGCCG
GTTGATGTTAAAGGACAAGATTTCGAATATTTACCATTTGGATCCGGCCG
AAGAATTTGTCCTGGGATTAATTTGGGATTAATAATGTCGGAGCTTGCGC
TTGCAAATCTCTTGTATTGTTTTGATTGGAAATTGCCGAATGGAAGGGAG
GAGGATTGTGTTAACATGAACATGGAGGAGGCAACTGGTGTGTCTCTCAC
TCTCTCTAAAAAGACGCCTCTTATCCTTGTGCCAGTCAATTACCTCCAGT
AGCATAGCCATCAGAAAAATGAAAGACAACAACAACATTGCTCTGTTGTA
ACTTCCTCAACTTCCTG
back to top