CB250360

Overview
NameCB250360
Unique NameCB250360
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length494
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB250360 vs. ExPASy Swiss-Prot
Match: PDAT_YEAST (Phospholipid:diacylglycerol acyltransferase OS=Saccharomyces cerevisiae GN=LRO1 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.134e-12
Identity = 38/108 (35.19%), Postives = 53/108 (49.07%), Query Frame = 3
Query:    9 HFMKWVEAPAPMXXXXXPDWCAKHIKAVMNIGGPFLGVPKAVAGLFSAEAKDVAVARAITPGFLDHDLFPHQTLQHLMRMTRTWDSTMSMIPKGGDTIWGGLDWSPEE 332
            +FMKWVEA  P+       W  +HI + +N  G  LG PKAV  L S E KD      +      + L    +    ++M +TW    SM+PKG + IWG +  S E+
Sbjct:  332 YFMKWVEAEGPLYGNGGRGWVNEHIDSFINAAGTLLGAPKAVPALISGEMKDTIQLNTLAM----YGLEKFFSRIERVKMLQTWGGIPSMLPKGEEVIWGDMKSSSED 435          
The following BLAST results are available for this feature:
BLAST of CB250360 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PDAT_YEAST2.134e-1235.19Phospholipid:diacylglycerol acyltransferase OS=Sac... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0154 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ223 similar to unknown Arabidopsis protein (acc# NP_196868), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250360 ID=CB250360|Name=CB250360|organism=Citrus sinensis|type=EST|length=494bp
ACTTTCTACATTTTATGAAGTGGGTCGAGGCACCAGCTCCAATGGGGGGT
GGTGGTGGACCTGATTGGTGTGCTAAGCATATAAAGGCAGTGATGAACAT
TGGTGGTCCATTTTTAGGTGTTCCAAAAGCTGTTGCTGGGCTTTTCTCTG
CTGAAGCTAAAGATGTTGCAGTTGCCAGGGCCATTACACCAGGTTTTTTG
GATCATGATCTTTTTCCTCATCAAACCTTGCAACATTTAATGAGGATGAC
CCGCACTTGGGATTCAACCATGTCAATGATACCGAAAGGCGGGGACACTA
TATGGGGTGGTCTTGACTGGTCACCTGAGGAATGCCATTCTCCTAGCAGA
AAAAGGCAAATAGCCAATGATACCCAGATTGCTAATGAAAATGGGAGTGA
AGTTGTGGTTTCTCAAAGAAAGCATGTAAATTATGGAAGAGTTATATCAT
TTGGAAAAGATGTAGCAGACGCACCTTCATCTGAGATTGAAAGG
back to top