CB250361

Overview
NameCB250361
Unique NameCB250361
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length403
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig121 contig Csv1_Contig121:1..403. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250361 vs. ExPASy Swiss-Prot
Match: FRI2_TOBAC (Ferritin-2, chloroplastic OS=Nicotiana tabacum GN=FER2 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.992e-19
Identity = 45/66 (68.18%), Postives = 54/66 (81.82%), Query Frame = 2
Query:  206 LKVSAAVDANSMPLTGVVFQPFEEVKKEVLDAPVSPLLSLARQKYEDECEAAINEQINVEYNVSYV 403
            L V A+  +N+ PLTGVVF+PFEEVKKE++  P  P +SLAR KY D+CEAA+NEQINVEYNVSYV
Sbjct:   44 LVVCASKGSNTKPLTGVVFEPFEEVKKELMLVPTVPQVSLARHKYSDQCEAAVNEQINVEYNVSYV 109          
BLAST of CB250361 vs. ExPASy Swiss-Prot
Match: FRI3_SOYBN (Ferritin-3, chloroplastic OS=Glycine max PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.570e-19
Identity = 46/68 (67.65%), Postives = 52/68 (76.47%), Query Frame = 2
Query:  200 RSLKVSAAVDANSMPLTGVVFQPFEEVKKEVLDAPVSPLLSLARQKYEDECEAAINEQINVEYNVSYV 403
            ++L   A  D N+ PLTGVVF+PFEEVKKE+   P  P  SLARQKY D+CEA INEQINVEYNVSYV
Sbjct:   39 KNLVPCATKDTNNRPLTGVVFEPFEEVKKELDLVPTVPQASLARQKYTDDCEATINEQINVEYNVSYV 106          
BLAST of CB250361 vs. ExPASy Swiss-Prot
Match: FRI1_TOBAC (Ferritin-1, chloroplastic OS=Nicotiana tabacum GN=FER1 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.570e-19
Identity = 46/73 (63.01%), Postives = 53/73 (72.60%), Query Frame = 2
Query:  185 SPRTKRSLKVSAAVDANSMPLTGVVFQPFEEVKKEVLDAPVSPLLSLARQKYEDECEAAINEQINVEYNVSYV 403
            SP+      VSA+   N  PLTGVVF+PFEE+KKE++  P  P  SL RQKY D+CEAAINEQINVEYN SYV
Sbjct:   30 SPKNGNRFVVSASKATNHKPLTGVVFEPFEELKKELMLVPAVPDTSLCRQKYSDDCEAAINEQINVEYNNSYV 102          
BLAST of CB250361 vs. ExPASy Swiss-Prot
Match: FRI1_BRANA (Ferritin-1, chloroplastic OS=Brassica napus GN=LSC30 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.686e-18
Identity = 45/63 (71.43%), Postives = 51/63 (80.95%), Query Frame = 2
Query:  215 SAAVDANSMPLTGVVFQPFEEVKKEVLDAPVSPLLSLARQKYEDECEAAINEQINVEYNVSYV 403
            S+ VD N+MP+TGVVFQPFEEVKK  L  P++   SLARQ+Y D  EAAINEQINVEYNVSYV
Sbjct:   48 SSTVDTNNMPMTGVVFQPFEEVKKADLAIPITSNASLARQRYADSSEAAINEQINVEYNVSYV 110          
BLAST of CB250361 vs. ExPASy Swiss-Prot
Match: FRI3_VIGUN (Ferritin-3, chloroplastic OS=Vigna unguiculata PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.203e-18
Identity = 47/90 (52.22%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  134 SSCYTKSTASLVKLGCISPRTKRSLKVSAAVDANSMPLTGVVFQPFEEVKKEVLDAPVSPLLSLARQKYEDECEAAINEQINVEYNVSYV 403
            S C + S ++ V  G       R+++V AA      PLTGV+F+PF+E+KK+ L  P++P +SL+RQ Y DE EAAINEQINVEYNVSYV
Sbjct:   27 SLCSSSSLSASVNGG-----GSRNMRVCAAASNAPAPLTGVIFEPFQELKKDYLAVPIAPNVSLSRQNYSDEAEAAINEQINVEYNVSYV 111          
BLAST of CB250361 vs. ExPASy Swiss-Prot
Match: FRI_MALXI (Ferritin, chloroplastic OS=Malus xiaojinensis PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 4.907e-18
Identity = 42/60 (70.00%), Postives = 50/60 (83.33%), Query Frame = 2
Query:  224 VDANSMPLTGVVFQPFEEVKKEVLDAPVSPLLSLARQKYEDECEAAINEQINVEYNVSYV 403
            V A+++PLTGV+F+PFEEVKK  L  P +P +SLARQ Y DECE+AINEQINVEYN SYV
Sbjct:   47 VCASTVPLTGVIFEPFEEVKKSELAVPTAPQVSLARQNYADECESAINEQINVEYNASYV 106          
BLAST of CB250361 vs. ExPASy Swiss-Prot
Match: FRI1_SOYBN (Ferritin-1, chloroplastic OS=Glycine max PE=1 SV=4)

HSP 1 Score: 89.7373 bits (221), Expect = 4.907e-18
Identity = 42/60 (70.00%), Postives = 50/60 (83.33%), Query Frame = 2
Query:  224 VDANSMPLTGVVFQPFEEVKKEVLDAPVSPLLSLARQKYEDECEAAINEQINVEYNVSYV 403
            V A+++PLTGV+F+PFEEVKK  L  P +P +SLARQ Y DECE+AINEQINVEYN SYV
Sbjct:   47 VCASTVPLTGVIFEPFEEVKKSELAVPTAPQVSLARQNYADECESAINEQINVEYNASYV 106          
BLAST of CB250361 vs. ExPASy Swiss-Prot
Match: FRI_PHAVU (Ferritin, chloroplastic OS=Phaseolus vulgaris GN=PFE PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.093e-17
Identity = 42/60 (70.00%), Postives = 50/60 (83.33%), Query Frame = 2
Query:  224 VDANSMPLTGVVFQPFEEVKKEVLDAPVSPLLSLARQKYEDECEAAINEQINVEYNVSYV 403
            V A+++PLTGV+F+PFEEVKKE L  P +  +SLARQ Y DECE+AINEQINVEYN SYV
Sbjct:   46 VSASTVPLTGVIFEPFEEVKKEELAVPTAGQVSLARQYYADECESAINEQINVEYNASYV 105          
BLAST of CB250361 vs. ExPASy Swiss-Prot
Match: FRI1_PEA (Ferritin-1, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 1.428e-17
Identity = 41/60 (68.33%), Postives = 48/60 (80.00%), Query Frame = 2
Query:  224 VDANSMPLTGVVFQPFEEVKKEVLDAPVSPLLSLARQKYEDECEAAINEQINVEYNVSYV 403
            V A + PLTGV+F+PFEEVKK+ L  P  PL+SLARQ + DECE+ INEQINVEYN SYV
Sbjct:   45 VSATTAPLTGVIFEPFEEVKKDYLAVPSVPLVSLARQNFADECESVINEQINVEYNASYV 104          
BLAST of CB250361 vs. ExPASy Swiss-Prot
Match: FRI1_ARATH (Ferritin-1, chloroplastic OS=Arabidopsis thaliana GN=FER1 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.428e-17
Identity = 46/69 (66.67%), Postives = 55/69 (79.71%), Query Frame = 2
Query:  200 RSLKVSAA-VDANSMPLTGVVFQPFEEVKKEVLDAPVSPLLSLARQKYEDECEAAINEQINVEYNVSYV 403
            R++ V+AA VD N+MP+TGVVFQPFEEVKK  L  P++   SLARQ++ D  EA INEQINVEYNVSYV
Sbjct:   43 RAVVVAAATVDTNNMPMTGVVFQPFEEVKKADLAIPITSHASLARQRFADASEAVINEQINVEYNVSYV 111          
The following BLAST results are available for this feature:
BLAST of CB250361 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
FRI2_TOBAC1.992e-1968.18Ferritin-2, chloroplastic OS=Nicotiana tabacum GN=... [more]
FRI3_SOYBN7.570e-1967.65Ferritin-3, chloroplastic OS=Glycine max PE=2 SV=1[more]
FRI1_TOBAC7.570e-1963.01Ferritin-1, chloroplastic OS=Nicotiana tabacum GN=... [more]
FRI1_BRANA1.686e-1871.43Ferritin-1, chloroplastic OS=Brassica napus GN=LSC... [more]
FRI3_VIGUN2.203e-1852.22Ferritin-3, chloroplastic OS=Vigna unguiculata PE=... [more]
FRI_MALXI4.907e-1870.00Ferritin, chloroplastic OS=Malus xiaojinensis PE=3... [more]
FRI1_SOYBN4.907e-1870.00Ferritin-1, chloroplastic OS=Glycine max PE=1 SV=4[more]
FRI_PHAVU1.093e-1770.00Ferritin, chloroplastic OS=Phaseolus vulgaris GN=P... [more]
FRI1_PEA1.428e-1768.33Ferritin-1, chloroplastic OS=Pisum sativum PE=1 SV... [more]
FRI1_ARATH1.428e-1766.67Ferritin-1, chloroplastic OS=Arabidopsis thaliana ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0155 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ224 similar to ferritin 2 (acc# AAN06322), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250361 ID=CB250361|Name=CB250361|organism=Citrus sinensis|type=EST|length=403bp
GCCATTCTTCTTCATCAAATTCATTTGCTTTCTTCCTTCAATCTCCATTA
CGCACTTGCTTACATCAATGGCATTGGCAGCTTCTTCTTCCTCCTCTCTT
GCAGCGAAGCAACTGGCTGGTCTTATAACAAGCTCATCATGTTACACTAA
GTCTACTGCTTCTCTTGTGAAATTGGGTTGTATTTCGCCGAGAACGAAGA
GGAGTCTGAAGGTTTCTGCTGCTGTGGACGCCAATAGCATGCCGCTGACC
GGGGTCGTGTTTCAGCCATTCGAAGAGGTCAAGAAAGAGGTTCTTGATGC
TCCTGTTTCCCCTCTGCTTTCACTAGCTCGCCAAAAGTATGAGGACGAGT
GTGAGGCCGCTATCAACGAGCAGATCAATGTGGAATATAATGTCTCATAC
GTG
back to top