CB250363

Overview
NameCB250363
Unique NameCB250363
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length359
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7363 contig Csv1_Contig7363:676..1034. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250363 vs. ExPASy Swiss-Prot
Match: AGD13_ARATH (Probable ADP-ribosylation factor GTPase-activating protein AGD13 OS=Arabidopsis thaliana GN=AGD13 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.505e-35
Identity = 73/102 (71.57%), Postives = 88/102 (86.27%), Query Frame = 1
Query:    1 THVSKVLSVTLDDWSDDEVDAMIEVGGNSSANAIYEAFIPEGVSKPGPDSSHEIRSKFIRSKYELQEFLKPSLRIASG----KPSASLQSSFSRKIIDSFRS 294
            TH+SKVLSVTLD+WSD+EVD+MIE+GGN+SAN+IYEAF+P+  SKPGPD +H+ R +FIR+KYELQEFLKPSLRI SG    K SA L SS SRKI+DSFR+
Sbjct:   62 THISKVLSVTLDEWSDEEVDSMIEIGGNASANSIYEAFLPDTCSKPGPDVNHDQRMRFIRAKYELQEFLKPSLRITSGKGSTKSSAFLTSSLSRKIMDSFRT 163          
BLAST of CB250363 vs. ExPASy Swiss-Prot
Match: AGD12_ARATH (ADP-ribosylation factor GTPase-activating protein AGD12 OS=Arabidopsis thaliana GN=AGD12 PE=1 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 3.353e-35
Identity = 73/103 (70.87%), Postives = 88/103 (85.44%), Query Frame = 1
Query:    1 THVSKVLSVTLDDWSDDEVDAMIEVGGNSSANAIYEAFIPEGVSKPGPDSSHEIRSKFIRSKYELQEFLKPSLRI-----ASGKPSASLQSSFSRKIIDSFRS 294
            +H+SKVLSVTLD+WSD+EVD+MIE+GGN+SAN+IYEAFIPEG SKPGPD+SH+ R +FIRSKYE QEFLKPSLRI     +S K  A L SS S+KI+DSFR+
Sbjct:   62 SHISKVLSVTLDEWSDEEVDSMIEIGGNASANSIYEAFIPEGSSKPGPDASHDQRMRFIRSKYEHQEFLKPSLRITSVRGSSTKTPAFLSSSLSKKIVDSFRT 164          
BLAST of CB250363 vs. ExPASy Swiss-Prot
Match: AGD11_ARATH (Probable ADP-ribosylation factor GTPase-activating protein AGD11 OS=Arabidopsis thaliana GN=AGD11 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.913e-14
Identity = 35/70 (50.00%), Postives = 50/70 (71.43%), Query Frame = 1
Query:    4 HVSKVLSVTLDDWSDDEVDAMIEVGGNSSANAIYEAFIPEGVSKPGPDSSHEIRSKFIRSKYELQEFLKP 213
            H+SKVLSV LD+W+DD+VD ++  GGN++ N  +EA   +   KP PDS++E R+ FIR KYE  +F+ P
Sbjct:   95 HISKVLSVKLDEWTDDQVDMLVGYGGNTAVNERFEACNIDQSKKPKPDSTNEERNDFIRKKYEQHQFMDP 164          
The following BLAST results are available for this feature:
BLAST of CB250363 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
AGD13_ARATH1.505e-3571.57Probable ADP-ribosylation factor GTPase-activating... [more]
AGD12_ARATH3.353e-3570.87ADP-ribosylation factor GTPase-activating protein ... [more]
AGD11_ARATH1.913e-1450.00Probable ADP-ribosylation factor GTPase-activating... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0157 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ228 similar to putative zinc finger and C2 domain protein (acc# AAM61306), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250363 ID=CB250363|Name=CB250363|organism=Citrus sinensis|type=EST|length=359bp
ACGCATGTCTCGAAGGTTTTGTCTGTGACATTGGATGACTGGTCTGATGA
TGAAGTTGATGCCATGATTGAAGTTGGAGGAAATTCATCTGCTAATGCAA
TTTATGAGGCTTTTATACCCGAAGGTGTTTCAAAGCCTGGACCAGATTCC
AGTCATGAGATACGTTCGAAGTTTATCAGGTCTAAGTATGAACTTCAAGA
ATTTTTGAAACCTAGCTTGCGGATTGCATCAGGAAAGCCTTCTGCCTCTC
TCCAATCAAGTTTTTCTCGAAAAATTATAGATAGCTTTCGAAGTCGGATC
ATGAGGTTCTCCTGACTTTGTCCAAATCGGGTGTTGTTGATCTGATTGGC
AAGGAGTGG
back to top