CB250370

Overview
NameCB250370
Unique NameCB250370
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length346
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12590 contig Csv1_Contig12590:294..639. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250370 vs. ExPASy Swiss-Prot
Match: EXPA8_ARATH (Expansin-A8 OS=Arabidopsis thaliana GN=EXPA8 PE=2 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 5.570e-59
Identity = 98/115 (85.22%), Postives = 108/115 (93.91%), Query Frame = 1
Query:    1 TALFNNGLSCGSCYEMKCENDPKWCLPGSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGD 345
            TALFNNGL+CG+CYEMKC +DP+WCL  +I VTATNFCPPN  LSNDNGGWCNPPLQHFD+AEPAFLQIAQYRAGIVP+SFRR+PC KKGGIRFT+NGHSYFNLVLI+NVGGAGD
Sbjct:   70 TALFNNGLTCGACYEMKCNDDPRWCLGSTITVTATNFCPPNPGLSNDNGGWCNPPLQHFDLAEPAFLQIAQYRAGIVPVSFRRVPCMKKGGIRFTINGHSYFNLVLISNVGGAGD 184          
BLAST of CB250370 vs. ExPASy Swiss-Prot
Match: EXP10_ARATH (Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 4.715e-58
Identity = 94/115 (81.74%), Postives = 110/115 (95.65%), Query Frame = 1
Query:    1 TALFNNGLSCGSCYEMKCENDPKWCLPGSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGD 345
            TALFNNGLSCGSC+E++CEND KWCLPGSI+VTATNFCPPN AL+N+NGGWCNPPL+HFD+A+P F +IAQYRAGIVP+S+RR+PC ++GGIRFT+NGHSYFNLVLITNVGGAGD
Sbjct:   66 TALFNNGLSCGSCFEIRCENDGKWCLPGSIVVTATNFCPPNNALANNNGGWCNPPLEHFDLAQPVFQRIAQYRAGIVPVSYRRVPCRRRGGIRFTINGHSYFNLVLITNVGGAGD 180          
BLAST of CB250370 vs. ExPASy Swiss-Prot
Match: EXPA2_ARATH (Expansin-A2 OS=Arabidopsis thaliana GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 216.083 bits (549), Expect = 4.413e-56
Identity = 91/115 (79.13%), Postives = 109/115 (94.78%), Query Frame = 1
Query:    1 TALFNNGLSCGSCYEMKCENDPKWCLPGSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGD 345
            TALFN+G  CG+C+E++CE+DP+WC+PGSIIV+ATNFCPPN AL+NDNGGWCNPPL+HFD+AEPAFLQIAQYRAGIVP++FRR+PC K GGIRFT+NG+ YF+LVLITNVGGAGD
Sbjct:   72 TALFNSGQKCGACFELQCEDDPEWCIPGSIIVSATNFCPPNFALANDNGGWCNPPLKHFDLAEPAFLQIAQYRAGIVPVAFRRVPCEKGGGIRFTINGNPYFDLVLITNVGGAGD 186          
BLAST of CB250370 vs. ExPASy Swiss-Prot
Match: EXPA1_ARATH (Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 2.861e-55
Identity = 89/115 (77.39%), Postives = 107/115 (93.04%), Query Frame = 1
Query:    1 TALFNNGLSCGSCYEMKCENDPKWCLPGSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGD 345
            TALFNNGLSCG+C+E++C+ND KWCLPGSI+VTATNFCPPN AL N+ GGWCNPP QHFD+++P F +IAQYRAGIVP+++RR+PC ++GGIRFT+NGHSYFNLVLITNVGGAGD
Sbjct:   67 TALFNNGLSCGACFEIRCQNDGKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRFTINGHSYFNLVLITNVGGAGD 181          
BLAST of CB250370 vs. ExPASy Swiss-Prot
Match: EXPA2_ORYSJ (Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 209.149 bits (531), Expect = 5.395e-54
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 1
Query:    1 TALFNNGLSCGSCYEMKCENDPKWCLPGSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGD 345
            T LFN+G +CGSCYE++C+ND +WCLPGS+ VTATN CPPN AL ND+GGWCNPP  HFDMAEPAFLQI  YRAGIVP+S+RR+PC KKGGIRFT+NGHSYFNLVL+TNV G GD
Sbjct:   69 TVLFNDGAACGSCYELRCDNDGQWCLPGSVTVTATNLCPPNYALPNDDGGWCNPPRPHFDMAEPAFLQIGVYRAGIVPVSYRRVPCVKKGGIRFTINGHSYFNLVLVTNVAGPGD 183          
BLAST of CB250370 vs. ExPASy Swiss-Prot
Match: EXP15_ARATH (Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=2 SV=2)

HSP 1 Score: 208.764 bits (530), Expect = 7.046e-54
Identity = 86/115 (74.78%), Postives = 106/115 (92.17%), Query Frame = 1
Query:    1 TALFNNGLSCGSCYEMKCENDPKWCLPGSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGD 345
            TALFNNGLSCG+C+E+KC++D  WCLPG+IIVTATNFCPPN AL N+ GGWCNPPL HFD+++P F +IAQY+AG+VP+S+RR+PC ++GGIRFT+NGHSYFNLVL+TNVGGAGD
Sbjct:   70 TALFNNGLSCGACFEIKCQSDGAWCLPGAIIVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQRIAQYKAGVVPVSYRRVPCMRRGGIRFTINGHSYFNLVLVTNVGGAGD 184          
BLAST of CB250370 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSJ (Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 3.497e-53
Identity = 90/115 (78.26%), Postives = 101/115 (87.83%), Query Frame = 1
Query:    1 TALFNNGLSCGSCYEMKCENDPKWCLPGSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGD 345
            TALFN+G +CGSCYE++C+N    CLPGSI VTATNFCPPN  L +D+GGWCNPP  HFDMAEPAFL IAQYRAGIVP+SFRR+PC KKGG+RFTVNGHSYFNLVL+TNV GAGD
Sbjct:   64 TALFNDGAACGSCYELRCDNAGSSCLPGSITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGD 178          
BLAST of CB250370 vs. ExPASy Swiss-Prot
Match: EXPA4_ORYSI (Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4 PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 3.497e-53
Identity = 90/115 (78.26%), Postives = 101/115 (87.83%), Query Frame = 1
Query:    1 TALFNNGLSCGSCYEMKCENDPKWCLPGSIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGD 345
            TALFN+G +CGSCYE++C+N    CLPGSI VTATNFCPPN  L +D+GGWCNPP  HFDMAEPAFL IAQYRAGIVP+SFRR+PC KKGG+RFTVNGHSYFNLVL+TNV GAGD
Sbjct:   64 TALFNDGAACGSCYELRCDNAGSSCLPGSITVTATNFCPPNYGLPSDDGGWCNPPRPHFDMAEPAFLHIAQYRAGIVPVSFRRVPCVKKGGVRFTVNGHSYFNLVLVTNVAGAGD 178          
BLAST of CB250370 vs. ExPASy Swiss-Prot
Match: EXPA4_ARATH (Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 7.790e-53
Identity = 88/117 (75.21%), Postives = 104/117 (88.89%), Query Frame = 1
Query:    1 TALFNNGLSCGSCYEMKCENDPKWCLPGS--IIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGD 345
            TALFNNG+SCG+C+E+KC NDP+WC  GS  I++TATNFCPPNLA  +DNGGWCNPP +HFD+A P FL+IAQYRAGIVP+S+RR+PC K+GGIRFT+NGH YFNLVLITNV GAGD
Sbjct:   71 TALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITNVAGAGD 187          
BLAST of CB250370 vs. ExPASy Swiss-Prot
Match: EXPA9_ARATH (Expansin-A9 OS=Arabidopsis thaliana GN=EXPA9 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 5.049e-52
Identity = 88/117 (75.21%), Postives = 102/117 (87.18%), Query Frame = 1
Query:    1 TALFNNGLSCGSCYEMKCENDPKWCLPG--SIIVTATNFCPPNLALSNDNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPISFRRIPCAKKGGIRFTVNGHSYFNLVLITNVGGAGD 345
            TALFNNGLSCGSC+E+KC NDP WCLPG  SI++TATNFCPPN   ++DNGGWCNPP +HFD+A P FL IA+Y+AGIVP+S+RRIPC KKGGIRFT+NG  YFNLVL+TNV GAGD
Sbjct:   72 TALFNNGLSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNFNQASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKYFNLVLVTNVAGAGD 188          
The following BLAST results are available for this feature:
BLAST of CB250370 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 59
Match NameE-valueIdentityDescription
EXPA8_ARATH5.570e-5985.22Expansin-A8 OS=Arabidopsis thaliana GN=EXPA8 PE=2 ... [more]
EXP10_ARATH4.715e-5881.74Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=... [more]
EXPA2_ARATH4.413e-5679.13Expansin-A2 OS=Arabidopsis thaliana GN=EXPA2 PE=2 ... [more]
EXPA1_ARATH2.861e-5577.39Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 ... [more]
EXPA2_ORYSJ5.395e-5476.52Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXP15_ARATH7.046e-5474.78Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=... [more]
EXPA4_ORYSJ3.497e-5378.26Expansin-A4 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA4_ORYSI3.497e-5378.26Expansin-A4 OS=Oryza sativa subsp. indica GN=EXPA4... [more]
EXPA4_ARATH7.790e-5375.21Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 ... [more]
EXPA9_ARATH5.049e-5275.21Expansin-A9 OS=Arabidopsis thaliana GN=EXPA9 PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0168 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ243 similar to expansin (acc# AAC33530), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250370 ID=CB250370|Name=CB250370|organism=Citrus sinensis|type=EST|length=346bp
ACCGCTCTATTCAACAATGGCCTAAGCTGTGGTTCATGCTATGAAATGAA
ATGTGAAAATGACCCCAAGTGGTGCCTCCCCGGCTCCATCATTGTCACCG
CCACCAACTTCTGCCCACCTAACCTTGCCCTGTCTAACGACAACGGCGGT
TGGTGCAATCCTCCCCTCCAGCACTTTGACATGGCTGAGCCCGCTTTCTT
GCAAATTGCCCAATACCGCGCCGGTATCGTCCCAATTTCCTTCAGAAGGA
TCCCGTGTGCGAAGAAAGGAGGAATAAGGTTTACCGTCAATGGACACTCA
TACTTCAACCTGGTTTTGATCACAAATGTCGGAGGAGCAGGAGATG
back to top