CB250372

Overview
NameCB250372
Unique NameCB250372
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length383
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB250372 vs. ExPASy Swiss-Prot
Match: MLO11_ARATH (MLO-like protein 11 OS=Arabidopsis thaliana GN=MLO11 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 2.251e-39
Identity = 87/130 (66.92%), Postives = 98/130 (75.38%), Query Frame = 3
Query:    6 RLILGFAGQFLCSYSTLPLYALVTQMGTNYKAALIPRRIRETIHGWGKAARRKRRLGQFTDDSTIHTVTDASTVASLEEYDHQLIDIPETAIGAGNST----GAEVELQPRNISNSPASVPNETSSRVDT 383
            RL+LGFAGQFLCSYSTLPLYALVTQMGTNYKAALIP+RIRETI GWGKA RRKRR G + DDST+ T T  ST+ASLEEYDHQ++D+ ET+             E+ELQP    N    VPN+TSSRV T
Sbjct:  410 RLLLGFAGQFLCSYSTLPLYALVTQMGTNYKAALIPQRIRETIRGWGKATRRKRRHGLYGDDSTVRTET--STIASLEEYDHQVLDVTETSFEQQRKQQEQGTTELELQPIQPRND--CVPNDTSSRVGT 535          
BLAST of CB250372 vs. ExPASy Swiss-Prot
Match: MLO14_ARATH (MLO-like protein 14 OS=Arabidopsis thaliana GN=MLO14 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 8.285e-34
Identity = 79/140 (56.43%), Postives = 97/140 (69.29%), Query Frame = 3
Query:    3 LRLILGFAGQFLCSYSTLPLYALVTQMGTNYKAALIPRRIRETIHGWGKAARRKRRLGQFTDDSTIHTVTDASTVASLEEYDHQLIDIPETAI-------------GAGNSTGAEVELQPRNISNSPASVPNETSSRVDT 383
            LRLILGF+GQFLCSYSTLPLYALVTQMGTNYKAAL+P+R+RETI+GWGKA RRKRR G + DDSTI T T  ST+AS++EY+ Q++D+ ET+                GNS+  E       I    AS+ + T SR+ T
Sbjct:  404 LRLILGFSGQFLCSYSTLPLYALVTQMGTNYKAALLPQRVRETINGWGKATRRKRRHGLYGDDSTIRTET--STIASVDEYNDQVLDVSETSPVQDNELELQLIRGACGNSSSVETP-----ILRPCASISSTTFSRLQT 536          
BLAST of CB250372 vs. ExPASy Swiss-Prot
Match: MLO15_ARATH (MLO-like protein 15 OS=Arabidopsis thaliana GN=MLO15 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.424e-11
Identity = 34/69 (49.28%), Postives = 45/69 (65.22%), Query Frame = 3
Query:    6 RLILGFAGQFLCSYSTLPLYALVTQMGTNYKAALIPRRIRETIHGWGKAARRKRRLGQFTDDSTIHTVT 212
            RL++G   Q LCSYSTLPLYALVTQMG+++K A+   + +E + GW K A+R  + G  T   T H  T
Sbjct:  396 RLVIGVIIQLLCSYSTLPLYALVTQMGSSFKGAIFNEQTQEHLVGWAKMAKRGVKKGA-TQVGTSHDAT 463          
BLAST of CB250372 vs. ExPASy Swiss-Prot
Match: MLO4_ARATH (MLO-like protein 4 OS=Arabidopsis thaliana GN=MLO4 PE=2 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 5.778e-11
Identity = 36/111 (32.43%), Postives = 60/111 (54.05%), Query Frame = 3
Query:    6 RLILGFAGQFLCSYSTLPLYALVTQMGTNYKAALIPRRIRETIHGWGKAARRKRRLGQFT-----------DDSTIHTVTDASTVASLEEYDHQLIDIPETAIGAGNSTGA 305
            RLI G   QF CSY T+PL  +VTQMG+ +K A+I   +R+++H W K  + + +  +             D+ T+ T++ +S++ SL +     ID  E+  GA  S+ +
Sbjct:  398 RLISGVLVQFWCSYGTVPLNVIVTQMGSRHKKAVIAESVRDSLHSWCKRVKERSKHTRSVCSLDTATIDERDEMTVGTLSRSSSMTSLNQITINSIDQAESIFGAAASSSS 508          
The following BLAST results are available for this feature:
BLAST of CB250372 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
MLO11_ARATH2.251e-3966.92MLO-like protein 11 OS=Arabidopsis thaliana GN=MLO... [more]
MLO14_ARATH8.285e-3456.43MLO-like protein 14 OS=Arabidopsis thaliana GN=MLO... [more]
MLO15_ARATH4.424e-1149.28MLO-like protein 15 OS=Arabidopsis thaliana GN=MLO... [more]
MLO4_ARATH5.778e-1132.43MLO-like protein 4 OS=Arabidopsis thaliana GN=MLO4... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0170 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ246 similar to unknown Arabidopsis protein (NP_200187), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250372 ID=CB250372|Name=CB250372|organism=Citrus sinensis|type=EST|length=383bp
ACTTACGACTTATTCTGGGGTTTGCTGGACAATTCCTCTGCAGCTACAGC
ACCCTGCCTCTCTATGCATTGGTTACTCAGATGGGAACAAACTATAAGGC
AGCACTAATTCCACGTCGGATTAGGGAGACCATCCATGGATGGGGGAAAG
CTGCTAGAAGGAAGAGAAGGCTTGGACAGTTTACTGATGATTCAACCATA
CACACAGTCACAGATGCAAGCACTGTAGCATCACTTGAGGAATATGATCA
TCAATTGATTGATATTCCTGAAACTGCTATTGGTGCTGGCAATAGCACTG
GTGCTGAAGTTGAATTACAGCCACGCAACATCTCTAACTCTCCTGCCTCA
GTTCCTAACGAGACTTCAAGTCGTGTTGATACC
back to top