CB250383

Overview
NameCB250383
Unique NameCB250383
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length245
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9615 contig Csv1_Contig9615:181..425. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250383 vs. ExPASy Swiss-Prot
Match: CYB5_TOBAC (Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 9.344e-38
Identity = 71/81 (87.65%), Postives = 78/81 (96.30%), Query Frame = 3
Query:    3 LAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDIDSSTVPTKTK 245
            LAEVS HN+ KDCWL+I GKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSA+AM+DE+YVGDIDS+T+PTKTK
Sbjct:   10 LAEVSQHNNAKDCWLVISGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSARAMLDEYYVGDIDSATIPTKTK 90          
BLAST of CB250383 vs. ExPASy Swiss-Prot
Match: CYB5S_TOBAC (Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 6.696e-36
Identity = 68/81 (83.95%), Postives = 76/81 (93.83%), Query Frame = 3
Query:    3 LAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDIDSSTVPTKTK 245
            LAEVS HN+ KDCWLII GKVY+VTKFL+DHPGG EVLLSATGKDATDDFED+GHSSSA+AM+DE+YVGDIDSST+PTK K
Sbjct:   10 LAEVSNHNNAKDCWLIISGKVYNVTKFLEDHPGGGEVLLSATGKDATDDFEDIGHSSSARAMLDEYYVGDIDSSTIPTKVK 90          
BLAST of CB250383 vs. ExPASy Swiss-Prot
Match: CYB5_BOROF (Cytochrome b5 OS=Borago officinalis PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.545e-35
Identity = 66/81 (81.48%), Postives = 77/81 (95.06%), Query Frame = 3
Query:    3 LAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDIDSSTVPTKTK 245
            LAEV+ HN+ KDCWLII GKVYDVTKFL+DHPGGD+VLLSATGKDATDDFED+GHSSSAKAM+DE+YVGDIDSS++P++ K
Sbjct:    7 LAEVAQHNNSKDCWLIINGKVYDVTKFLEDHPGGDDVLLSATGKDATDDFEDIGHSSSAKAMLDEYYVGDIDSSSIPSQVK 87          
BLAST of CB250383 vs. ExPASy Swiss-Prot
Match: CYB5_ORYSJ (Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 9.050e-33
Identity = 61/81 (75.31%), Postives = 75/81 (92.59%), Query Frame = 3
Query:    3 LAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDIDSSTVPTKTK 245
            L EV+ HN + DCWLII GKVY+V+KFL+DHPGGD+VLLS+TGKDATDDFEDVGHS++A+AMMDE+YVGDID+ST+P +TK
Sbjct:   11 LEEVAKHNSKDDCWLIIGGKVYNVSKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSTTARAMMDEYYVGDIDTSTIPARTK 91          
BLAST of CB250383 vs. ExPASy Swiss-Prot
Match: CYB5_CUSRE (Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 2.016e-32
Identity = 64/80 (80.00%), Postives = 71/80 (88.75%), Query Frame = 3
Query:    3 LAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDIDSSTVPTKT 242
            LAEVS H+   DCWL+I GKVYDVTKFLDDHPGG +VLLS+T KDATDDFED+GHSSSA+AMMDE  VGDIDSST+PTKT
Sbjct:    9 LAEVSEHSQPNDCWLVIGGKVYDVTKFLDDHPGGADVLLSSTAKDATDDFEDIGHSSSARAMMDEMCVGDIDSSTIPTKT 88          
BLAST of CB250383 vs. ExPASy Swiss-Prot
Match: CYB52_ARATH (Probable cytochrome b5 isoform 2 OS=Arabidopsis thaliana GN=At2g32720 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 8.471e-31
Identity = 57/81 (70.37%), Postives = 71/81 (87.65%), Query Frame = 3
Query:    3 LAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDIDSSTVPTKTK 245
            L+EVS HN   DCW++I GKVY+VTKFL+DHPGGD+VLLS+TGKDATDDFEDVGHS SA+ MM+++YVG+ID +T+P K K
Sbjct:   10 LSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSESAREMMEQYYVGEIDPTTIPKKVK 90          
BLAST of CB250383 vs. ExPASy Swiss-Prot
Match: CYB5_BRAOB (Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 2.465e-30
Identity = 58/75 (77.33%), Postives = 68/75 (90.67%), Query Frame = 3
Query:    9 EVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDIDSSTVP 233
            EVS HN  KDCWLII GKVYDVT F+DDHPGGDEVLLS+TGKDAT+DFEDVGHS +A+ MM+++Y+G+IDSSTVP
Sbjct:   12 EVSQHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTARDMMEKYYIGEIDSSTVP 86          
BLAST of CB250383 vs. ExPASy Swiss-Prot
Match: CYB51_ARATH (Cytochrome b5 isoform 1 OS=Arabidopsis thaliana GN=At5g53560 PE=2 SV=2)

HSP 1 Score: 129.028 bits (323), Expect = 7.171e-30
Identity = 57/75 (76.00%), Postives = 68/75 (90.67%), Query Frame = 3
Query:    9 EVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDIDSSTVP 233
            EVS HN  KDCWLII GKVYDVT F+DDHPGGDEVLLS+TGKDAT+DFEDVGHS +A+ MMD++++G+IDSS+VP
Sbjct:   12 EVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTARDMMDKYFIGEIDSSSVP 86          
BLAST of CB250383 vs. ExPASy Swiss-Prot
Match: CYB5B_HUMAN (Cytochrome b5 type B OS=Homo sapiens GN=CYB5B PE=1 SV=2)

HSP 1 Score: 97.4413 bits (241), Expect = 2.312e-20
Identity = 42/74 (56.76%), Postives = 57/74 (77.03%), Query Frame = 3
Query:    3 LAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDIDSS 224
            L EV+  N  K+ WL+I G+VYDVT+FL++HPGG+EVLL   G DA++ FEDVGHSS A+ M+ ++Y+GDI  S
Sbjct:   25 LEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPS 98          
BLAST of CB250383 vs. ExPASy Swiss-Prot
Match: CYB5B_PONAB (Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 3.944e-20
Identity = 41/74 (55.41%), Postives = 57/74 (77.03%), Query Frame = 3
Query:    3 LAEVSGHNDRKDCWLIIEGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFEDVGHSSSAKAMMDEFYVGDIDSS 224
            + EV+  N  K+ WL+I G+VYDVT+FL++HPGG+EVLL   G DA++ FEDVGHSS A+ M+ ++Y+GDI  S
Sbjct:   25 MEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPS 98          
The following BLAST results are available for this feature:
BLAST of CB250383 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 67
Match NameE-valueIdentityDescription
CYB5_TOBAC9.344e-3887.65Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1[more]
CYB5S_TOBAC6.696e-3683.95Cytochrome b5, seed isoform OS=Nicotiana tabacum P... [more]
CYB5_BOROF2.545e-3581.48Cytochrome b5 OS=Borago officinalis PE=2 SV=1[more]
CYB5_ORYSJ9.050e-3375.31Cytochrome b5 OS=Oryza sativa subsp. japonica GN=O... [more]
CYB5_CUSRE2.016e-3280.00Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1[more]
CYB52_ARATH8.471e-3170.37Probable cytochrome b5 isoform 2 OS=Arabidopsis th... [more]
CYB5_BRAOB2.465e-3077.33Cytochrome b5 OS=Brassica oleracea var. botrytis G... [more]
CYB51_ARATH7.171e-3076.00Cytochrome b5 isoform 1 OS=Arabidopsis thaliana GN... [more]
CYB5B_HUMAN2.312e-2056.76Cytochrome b5 type B OS=Homo sapiens GN=CYB5B PE=1... [more]
CYB5B_PONAB3.944e-2055.41Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0185 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ268 similar to cytochrome b5 (acc# P49098), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250383 ID=CB250383|Name=CB250383|organism=Citrus sinensis|type=EST|length=245bp
CTTTGGCTGAGGTCTCTGGGCACAACGACCGCAAGGACTGTTGGCTTATC
ATTGAGGGCAAGGTATATGATGTGACAAAATTCTTGGATGACCATCCTGG
TGGAGACGAGGTATTGTTGTCTGCCACAGGAAAGGATGCGACTGACGACT
TTGAGGATGTTGGTCACAGTAGCAGTGCAAAAGCGATGATGGATGAATTC
TATGTGGGTGACATTGATTCATCAACCGTTCCCACCAAGACCAAG
back to top