CB290204

Overview
NameCB290204
Unique NameCB290204
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length797
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13457 contig Csv1_Contig13457:927..1723. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB290204 vs. ExPASy Swiss-Prot
Match: C76B1_HELTU (7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 6.910e-63
Identity = 123/254 (48.43%), Postives = 171/254 (67.32%), Query Frame = 2
Query:   35 MDTVSCVPWLLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGNKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFSIDLADPTSKTAREFKQTNWGMMEEAGKPNLSDFFPVLENLDLXGIRRRMTVYFGKMLDVFDRL 796
            MD +  V  LL S+IL+  L           + LPPGPT  P+IGNL  LG  PH+SLAKLAKIHGPIMSL+ GQ+TT+V SSA  A+E+L+ QD +F  R +PDA+ A+ H    + +L V T WR LR+I +S+ FS+  L+A QHLR KK+++L+AY ++   +   +HIG+AAF T+LNL+SNTIFS DL DP   + +EF++    +M ++ K NL D FPVL+ +D  GI+R M  +F K+L +FD+L
Sbjct:    1 MDFLIIVSTLLLSYILIWVLGV------GKPKNLPPGPTRLPIIGNLHLLGALPHQSLAKLAKIHGPIMSLQLGQITTLVISSATAAEEVLKKQDLAFSTRNVPDAVRAYNHERHSISFLHVCTEWRTLRRIVSSNIFSNSSLEAKQHLRSKKVEELIAYCRKAALSNENVHIGRAAFRTSLNLLSNTIFSKDLTDPYEDSGKEFREVITNIMVDSAKTNLVDVFPVLKKIDPQGIKRGMARHFSKVLGIFDQL 248          
BLAST of CB290204 vs. ExPASy Swiss-Prot
Match: C76C4_ARATH (Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.309e-45
Identity = 99/247 (40.08%), Postives = 150/247 (60.73%), Query Frame = 2
Query:   59 WLLFSWI---LVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGNKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATL-WRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFSIDLADPTSKTAREFKQTNWGMMEEAGKPNLSDFFPVLENLDLXGIRRRMTVYFGKMLDVF 787
            +LLF +I    +++    SR     +  LPPGP   P+IGN+ ++G  PH S A LAKI+GPIMSLKFG + +VV +S   A+E+L+  D     R   D+I   GH E  + WLP ++  WR LRK+  +  FS ++ +A + LR KK+Q+L++++ E+     A+ I +A++ T LN+ISN +FS+DL    SK + EF+ T  G ME AGKP+ +++FP +  LDL G R+ M     ++  VF
Sbjct:   10 FLLFCFISSCFLISTTARSRRSSGRAATLPPGPPRLPIIGNIHQVGKNPHSSFADLAKIYGPIMSLKFGCLNSVVITSPEAAREVLRTHDQILSGRKSNDSIRCFGHEEVSVIWLPPSSARWRMLRKLSVTLMFSPQRTEATKALRMKKVQELVSFMNESSERKEAVDISRASYTTVLNIISNILFSVDLGSYDSKKSNEFQDTVIGAMEAAGKPDAANYFPFMGFLDLQGNRKAMRGLTERLFRVF 256          
BLAST of CB290204 vs. ExPASy Swiss-Prot
Match: C76C3_ARATH (Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2)

HSP 1 Score: 175.637 bits (444), Expect = 2.730e-43
Identity = 91/224 (40.62%), Postives = 136/224 (60.71%), Query Frame = 2
Query:  119 SGSRRLPPGPTPYPVIGNLLELGNKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFSIDLAD-PTSKTAREFKQTNWGMMEEAGKPNLSDFFPVLENLDLXGIRRRMTVYFGKMLDVF 787
            S +  LPPGP   P++GN+ +LG  PH+SLA  +K +GPIMSLK G++T VV SS   AKE L+  D     RT  DA+ A  HH+  + W+P +  WR L+K    +  S + LDA Q LR +K+++L++ V E    G AI + +A+F T+ N+ISN +FS+DLA   ++ ++ EF  T   + + AG PN+ D+F  +  LDL G R++  +   K+  VF
Sbjct:   33 SSTGTLPPGPPILPLVGNIFQLGFNPHRSLAAFSKTYGPIMSLKLGRLTAVVISSPEAAKEALRTHDHVMSARTFNDALRAFDHHKHSIVWIPPSARWRFLKKTITKYLLSPQNLDAIQSLRMRKVEELVSLVNEFRERGEAIDLARASFVTSFNIISNALFSVDLATYDSNSSSYEFHNTVVHLTDIAGIPNVGDYFQYMRFLDLQGTRKKAVLCIEKLFRVF 256          
BLAST of CB290204 vs. ExPASy Swiss-Prot
Match: C76C2_ARATH (Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.498e-41
Identity = 91/245 (37.14%), Postives = 147/245 (60.00%), Query Frame = 2
Query:   65 LFSWILVVALNYFSRGFKSGSRRL---PPGPTPYPVIGNLLELGNKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATL-WRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFSIDLADPTSKTAREFKQTNWGMMEEAGKPNLSDFFPVLENLDLXGIRRRMTVYFGKMLDVF 787
            LF ++L   + +F+      SR++   PPGP   P+IGN+  +G  PH S A L+K +GPIMSLKFG + TVV +S   A+E+L+  D    +RT  ++I +  H +  + WLP ++  WR LRK+  +  FS ++++A + LR  K+++L++++ E+     A+ I +A F T LN+ISN +FS+DL +  S  +  F+ T  G+ME  G P+ ++FFP L  LDL G R+ +     ++  VF
Sbjct:   12 LFCFVLSFFIIFFTTTRPRSSRKVVPSPPGPPRLPIIGNIHLVGRNPHHSFADLSKTYGPIMSLKFGSLNTVVVTSPEAAREVLRTYDQILSSRTPTNSIRSINHDKVSVVWLPPSSSRWRLLRKLSATQLFSPQRIEATKTLRENKVKELVSFMSESSEREEAVDISRATFITALNIISNILFSVDLGNYDSNKSGVFQDTVIGVMEAVGNPDAANFFPFLGFLDLQGNRKTLKACSERLFKVF 256          
BLAST of CB290204 vs. ExPASy Swiss-Prot
Match: C80B1_ESCCA ((S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 4.079e-39
Identity = 80/215 (37.21%), Postives = 126/215 (58.60%), Query Frame = 2
Query:  119 SGSRRLPPGPTPYPVIGNLLELGNKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFS---IDLADPTSKTAREFKQTNWGMMEEAGKPNLSDFFPVLENLDLXGIRRRM 754
            SG + LPPGP P+P++GNLL+LG KPH   A+LA+ +G I +LK G  T VV S+++ A EIL+  D     R +  +    GH E  + W      W+NLRK+C +  F+ + +++  H+R KK ++++ Y+ +  + G  + I +  F T +N+  N IFS    +L DP S ++ EFK+  W M+E     N +D+FP+L   DL G R+ +
Sbjct:   23 SGHKNLPPGPKPWPIVGNLLQLGEKPHAQFAELAQTYGDIFTLKMGTETVVVASTSSAASEILKTHDRILSARYVFQSFRVKGHVENSIVWSDCTETWKNLRKVCRTELFTQKMIESQAHVREKKCEEMVEYLMK--KQGEEVKIVEVIFGTLVNIFGNLIFSQNIFELGDPNSGSS-EFKEYLWRMLELGNSTNPADYFPMLGKFDLFGQRKEV 234          
BLAST of CB290204 vs. ExPASy Swiss-Prot
Match: C80B2_ESCCA ((S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.550e-38
Identity = 81/229 (35.37%), Postives = 132/229 (57.64%), Query Frame = 2
Query:   77 ILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGNKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFS---IDLADPTSKTAREFKQTNWGMMEEAGKPNLSDFFPVLENLDLXGIRRRM 754
            +++ ++ Y   G  SG + LPPGP P+P++GNLL+LG KPH   A+LA+ +G I +LK G  T VV S+++ A EIL+  D     R +  +    GH E  + W      W+NLRK+C +  F+ + +++  H+R KK ++++ Y+ +  + G  + I +  F T +N+  N IFS    +L  P S ++ EFK+  W M+E     N +D+FP+L   DL G R+ +
Sbjct:   11 VIISSILYLLFG-SSGHKNLPPGPKPWPIVGNLLQLGEKPHAQFAELAQTYGDIFTLKMGTETVVVASTSSAASEILKTHDRILSARYVFQSFRVKGHVENSIVWSDCTETWKNLRKVCRTELFTQKMIESQAHVREKKCEEMVEYLMK--KQGEEVKIVEVIFGTLVNIFGNLIFSQNIFELGXPNSGSS-EFKEYLWRMLELGNSTNPADYFPMLGKFDLFGQRKEV 235          
BLAST of CB290204 vs. ExPASy Swiss-Prot
Match: C76C1_ARATH (Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.923e-37
Identity = 86/247 (34.82%), Postives = 145/247 (58.70%), Query Frame = 2
Query:   62 LLFSWILVVALNYF---SRGFKSGSRRLPPGPTPYPVIGNLLELGNKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATL-WRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFSIDLADPTSKTA-REFKQTNWGMMEEAGKPNLSDFFPVLENLDLXGIRRRMTVYFGKMLDVF 787
            LLF +IL   L +    S     G+  LPPGP   P+IGN+  +G  PH+S A+L+K +GP+MSLK G + TVV +S   A+E+L+  D     R+  +A+ +  H +  + WLP ++  WR LR++  +   S ++++A + LR  K+++L++++ E+     ++ I + AF TTLN+ISN +FS+DL    +K +    + T   +M+ AG P+ +++FP L  LDL G  +   V   +++ VF
Sbjct:   11 LLFCFILSCFLIFTTTRSGRISRGATALPPGPPRLPIIGNIHLVGKHPHRSFAELSKTYGPVMSLKLGSLNTVVIASPEAAREVLRTHDQILSARSPTNAVRSINHQDASLVWLPSSSARWRLLRRLSVTQLLSPQRIEATKALRMNKVKELVSFISESSDREESVDISRVAFITTLNIISNILFSVDLGSYNAKASINGVQDTVISVMDAAGTPDAANYFPFLRFLDLQGNVKTFKVCTERLVRVF 257          
BLAST of CB290204 vs. ExPASy Swiss-Prot
Match: C76A2_SOLME (Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.451e-36
Identity = 79/248 (31.85%), Postives = 137/248 (55.24%), Query Frame = 2
Query:   59 WLLFSWILVVA---LNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGNKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRA---GTAIHIGQAAFDTTLNLISNTIFSIDLADPTSKTAREFKQTNWGMMEEAGKPNLSDFFPVLENLDLXGIRRRMTVYFGKMLDV 784
            ++ FS I+++    L +  +     S + PPGP   P+ GN+ ELG +P+K +A L + +GP++ LK G   T+V  +A  ++E+ +N D SF NR IPD   AH +++  +   P    WR  R+IC    F  +++   + +RRK + ++L ++++   +   G+ I + +  F  + N++ N I S DLAD  S+ A EF      + E +G  N+SD FP L+  DL  +R++M    GK +++
Sbjct:    7 YVFFSAIIILPAFILFFSQKNTTKSSYKFPPGPPGLPIFGNMFELGTEPYKKMAVLRQKYGPVLWLKLGSTYTMVVQTAQASEELFKNHDISFANRVIPDVNQAHSYYQGSLAIAPYGPFWRFQRRICTIEMFVHKKISETEPVRRKCVDNMLKWIEKEANSAEKGSGIEVTRFVFLASFNMLGNLILSKDLADLESEEASEFFIAMKRINEWSGIANVSDIFPFLKKFDLQSLRKKMARDMGKAVEI 254          
BLAST of CB290204 vs. ExPASy Swiss-Prot
Match: F3PH_PETHY (Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.718e-29
Identity = 80/235 (34.04%), Postives = 123/235 (52.34%), Query Frame = 2
Query:   62 LLFSWILVVALNYFSRGFKSGSRRLPPGPTPYPVIGNLLELGNKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRAGTAIHIGQAAFDTTLNLISNTIFS----IDLADPTSKTAREFKQTNWGMMEEAGKPNLSDFFPVLENLDLXGIRRRM 754
            ++FS++L   L  F R  K     LPPGP P+P+IGNL+ LG KPH+S A +A+ +GP+M LK G V  VV +SA++A + L+  D +F +R          ++   + + P    WR LRKIC+ H FS++ LD  +H+R+ +++ L   +         + +GQ     T N ++  +       D +      A EFK     MM  AG  N+ DF P L  LD+ G+  +M
Sbjct:   11 VIFSFLLQFILRSFFR--KRYPLPLPPGPKPWPIIGNLVHLGPKPHQSTAAMAQTYGPLMYLKMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAEHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVRQDEVKTLTRALAS--AGQKPVKLGQLLNVCTTNALARVMLGKRVFADGSGDVDPQAAEFKSMVVEMMVVAGVFNIGDFIPQLNWLDIQGVAAKM 241          
BLAST of CB290204 vs. ExPASy Swiss-Prot
Match: C76A1_SOLME (Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 6.527e-29
Identity = 73/209 (34.93%), Postives = 115/209 (55.02%), Query Frame = 2
Query:  167 GNLLEL-GNKPHKSLAKLAKIHGPIMSLKFGQ-VTTVVFSSAAMAKEILQNQDTSFCNRTIPDAIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENCRA----GTAIHIGQAAFDTTLNLISNTIFSIDL-ADPTSKTAREFKQTNWGMMEEAGKPNLSDFFPVLENLDLXGIRRRMTVYFGK 772
            GN+ +L G+ P+K +A L + +GPI+ LK G  + T+V  +A  A E+ +N D SF +R I D   AH +++  M   P    WR  R+IC    F  ++++   ++R++ +  +L   +E   +    G  I + +  F  + N++ N IFS DL  DP SK   EF     G+ME AG PN+SD FP L+  D+ G+R++M    GK
Sbjct:    2 GNMFDLAGSAPYKKIACLKEKYGPILWLKIGSSMNTMVIQTANSASELFRNHDVSFSDRPIVDVNLAHNYYKGSMALAPYGNYWRFSRRICTVEMFVHKRINETTNIRQESVDKMLRLDEEKASSSGGGGEGIEVTRYMFLASFNMVGNMIFSKDLVTDPESKQGSEFFNAMIGIMEWAGVPNISDIFPCLKMFDVQGLRKKMERDMGK 210          
The following BLAST results are available for this feature:
BLAST of CB290204 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 116
Match NameE-valueIdentityDescription
C76B1_HELTU6.910e-6348.437-ethoxycoumarin O-deethylase OS=Helianthus tubero... [more]
C76C4_ARATH1.309e-4540.08Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CY... [more]
C76C3_ARATH2.730e-4340.63Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CY... [more]
C76C2_ARATH1.498e-4137.14Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CY... [more]
C80B1_ESCCA4.079e-3937.21(S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (F... [more]
C80B2_ESCCA1.550e-3835.37(S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS... [more]
C76C1_ARATH2.923e-3734.82Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CY... [more]
C76A2_SOLME1.451e-3631.85Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76... [more]
F3PH_PETHY1.718e-2934.04Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=C... [more]
C76A1_SOLME6.527e-2934.93Cytochrome P450 76A1 (Fragment) OS=Solanum melonge... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_01aa08_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01aa08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB290204 ID=CB290204|Name=CB290204|organism=Citrus sinensis|type=EST|length=797bp
GCCCGTTGTTCAACAAAAGAGAGCGAGATTAAAGATGGATACGGTAAGCT
GCGTACCATGGCTTCTATTCTCGTGGATTTTGGTCGTCGCTTTAAATTAC
TTTTCAAGAGGATTCAAATCTGGATCCAGAAGGCTTCCACCGGGACCGAC
GCCTTATCCGGTGATCGGAAACCTCCTGGAACTCGGCAACAAACCTCACA
AGTCACTTGCTAAACTTGCCAAGATTCATGGCCCCATAATGAGTCTAAAA
TTTGGCCAGGTGACCACAGTTGTCTTTTCTTCTGCAGCCATGGCCAAAGA
AATCCTTCAAAATCAAGACACATCTTTCTGTAATCGAACAATCCCAGACG
CAATCTACGCCCACGGCCATCATGAATTCGGGATGCCCTGGCTGCCTGTG
GCGACACTGTGGAGAAATCTTCGAAAAATATGCAACTCACATGCTTTCTC
TAGTCGCCAACTCGATGCCAATCAGCACCTTCGGCGTAAGAAAATCCAAG
ATCTTCTAGCTTATGTCCAAGAAAATTGCCGTGCAGGTACAGCAATACAT
ATTGGCCAAGCTGCTTTCGACACTACGCTTAATTTGATATCCAACACAAT
TTTTTCTATTGACTTGGCTGATCCCACATCAAAAACTGCGCGAGAGTTTA
AGCAAACAAATTGGGGTATGATGGAAGAAGCTGGAAAGCCTAACTTGTCC
GATTTTTTTCCTGTGCTTGAGAATCTTGACTTGNCAGGTATAAGGCGTCG
CATGACAGTTTATTTTGGCAAGATGCTCGATGTATTTGATCGCTTGA
back to top