CB290215

Overview
NameCB290215
Unique NameCB290215
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length774
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB290215_ssr286 microsatellite CB290215_ssr286:286..297. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CB290215 vs. ExPASy Swiss-Prot
Match: INVA_PHAAU (Acid beta-fructofuranosidase OS=Phaseolus aureus GN=INVA PE=1 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 3.239e-70
Identity = 117/165 (70.91%), Postives = 138/165 (83.64%), Query Frame = 2
Query:  287 SSSSKEPERLRPFTSASSAGVSEKSNRRF----GSRTASYPWTNNMLSWQRTAFHFQPQKNWMNDPNGPVFYKGWYHLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGSATILSDGKLMMLYTGSTNESVQVQNLAYPADPSDPLLI 769
            S +S    +  P +   S+GVSEKS+       G  + ++PW N+MLSWQRT+FHFQP+KNWMNDPNGP++YKGWYH FYQYNPNGA+WGDIVWGHAVS+D+IHW HLPLAMVADQWYD  GVWTGSATIL +G+++MLYTGSTNESVQVQNLAYPADPSDPLL+
Sbjct:   66 SPTSLPSSKWYPVSRGVSSGVSEKSSNLLFAGEGGASEAFPWDNSMLSWQRTSFHFQPEKNWMNDPNGPMYYKGWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDKQGVWTGSATILPNGEIIMLYTGSTNESVQVQNLAYPADPSDPLLL 230          
BLAST of CB290215 vs. ExPASy Swiss-Prot
Match: INVA_PHAVU (Acid beta-fructofuranosidase OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.231e-69
Identity = 114/148 (77.03%), Postives = 132/148 (89.19%), Query Frame = 2
Query:  338 SAGVSEKSNRRF----GSRTASYPWTNNMLSWQRTAFHFQPQKNWMNDPNGPVFYKGWYHLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGSATILSDGKLMMLYTGSTNESVQVQNLAYPADPSDPLLI 769
            S+GVSEKS+       G  + ++PW N+MLSWQRT+FHFQP+KNWMNDPNGP++YKGWYH FYQYNPNGA+WGDIVWGHAVS+D+IHW HLPLAMVADQWYD  GVWTGSATIL +G+++MLYTGSTNESVQVQNLAYPADPSDPLL+
Sbjct:   83 SSGVSEKSSSMLFSGEGGASEAFPWDNSMLSWQRTSFHFQPEKNWMNDPNGPMYYKGWYHFFYQYNPNGAVWGDIVWGHAVSRDMIHWLHLPLAMVADQWYDKQGVWTGSATILPNGEIIMLYTGSTNESVQVQNLAYPADPSDPLLV 230          
BLAST of CB290215 vs. ExPASy Swiss-Prot
Match: INVA_VICFA (Acid beta-fructofuranosidase OS=Vicia faba GN=VCINV PE=2 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 2.742e-69
Identity = 123/168 (73.21%), Postives = 136/168 (80.95%), Query Frame = 2
Query:  287 SSSSKEPERLRPFTSAS--SAGVSEKSNRRFGSRT-----ASYPWTNNMLSWQRTAFHFQPQKNWMNDPNGPVFYKGWYHLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGSATILSDGKLMMLYTGSTNESVQVQNLAYPADPSDPLLI 769
            SSS    E  RP T +   S+GVSEKSN    S        S+PW N MLSWQRTAFHFQP+KNWMNDPNGP++YKGWYH FYQYNPNGA+WGDIVWGHAVS+DLIHW HLPLAMVADQWYD  GVWTGSATIL DG+++MLYTGSTNE VQVQNLAYPAD +DPLL+
Sbjct:   55 SSSILSDEATRPTTLSRGVSSGVSEKSNTFLLSGNLVGEGGSFPWNNTMLSWQRTAFHFQPEKNWMNDPNGPLYYKGWYHFFYQYNPNGAVWGDIVWGHAVSRDLIHWLHLPLAMVADQWYDSNGVWTGSATILPDGQVIMLYTGSTNEFVQVQNLAYPADLNDPLLV 222          
BLAST of CB290215 vs. ExPASy Swiss-Prot
Match: INVB_DAUCA (Beta-fructofuranosidase, soluble isoenzyme I OS=Daucus carota GN=INV*DC4 PE=1 SV=2)

HSP 1 Score: 251.521 bits (641), Expect = 3.706e-66
Identity = 112/161 (69.57%), Postives = 134/161 (83.23%), Query Frame = 2
Query:  287 SSSSKEPERLRPFTSASSAGVSEKSNRRFGSRTASYPWTNNMLSWQRTAFHFQPQKNWMNDPNGPVFYKGWYHLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGSATILSDGKLMMLYTGSTNESVQVQNLAYPADPSDPLLI 769
            + +SK PE L P +   S GVSEKS R+  +   SYPWTN+MLSWQRT+FHFQPQ+NWMNDPNGP+F+ GWYHLFYQYNP+ AIWG+I WGHA+S+DLI+W HLP AM  DQWYDI GVWTGSAT+L DGK++MLYTG T++ VQVQNLAYPA+ SDPLL+
Sbjct:   86 NKASKSPEMLGPPSRGVSQGVSEKSFRQ-ATAEPSYPWTNDMLSWQRTSFHFQPQENWMNDPNGPLFHMGWYHLFYQYNPDSAIWGNITWGHAISRDLINWLHLPFAMQPDQWYDINGVWTGSATVLPDGKIVMLYTGDTDDLVQVQNLAYPANLSDPLLL 245          
BLAST of CB290215 vs. ExPASy Swiss-Prot
Match: INVA_SOLLC (Acid beta-fructofuranosidase OS=Solanum lycopersicum GN=TIV1 PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 2.248e-63
Identity = 109/151 (72.19%), Postives = 127/151 (84.11%), Query Frame = 2
Query:  320 PFTSASSAGVSEKSNRRF-GSRTASYPWTNNMLSWQRTAFHFQPQKNWMNDPNGPVFYKGWYHLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGSATILSDGKLMMLYTGSTNESVQVQNLAYPADPSDPLLI 769
            P +   S GVS+K+ R   G+   SY W+N MLSWQRTA+HFQPQKNWMNDPNGP+++KGWYHLFYQYNP+ AIWG+I WGHAVSKDLIHW +LP AMV DQWYDI GVWTGSATIL DG++MMLYTG T++ VQVQNLAYPA+ SDPLL+
Sbjct:   68 PPSRGVSQGVSDKTFRDVAGASHVSYAWSNAMLSWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSKDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGQIMMLYTGDTDDYVQVQNLAYPANLSDPLLL 218          
BLAST of CB290215 vs. ExPASy Swiss-Prot
Match: INV1_CAPAN (Acid beta-fructofuranosidase AIV-18 OS=Capsicum annuum PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.457e-62
Identity = 111/164 (67.68%), Postives = 130/164 (79.27%), Query Frame = 2
Query:  287 SSSSKEPERLRPFTSAS--SAGVSEKSNRRF-GSRTASYPWTNNMLSWQRTAFHFQPQKNWMNDPNGPVFYKGWYHLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGSATILSDGKLMMLYTGSTNESVQVQNLAYPADPSDPLLI 769
            + S    E L P T +   S GVSEK+ +   G+   SY W+N ML+WQRTA+HFQPQKNWMNDPNGP+++KGWYHLFYQYNP+ AIWG+I WGHAVS DLIHW +LP AMV DQWYDI GVWTGSATIL DG +MMLYTG T++ VQVQNLAYPA+ SDPLL+
Sbjct:   63 NKSPSASETLTPATPSRGVSQGVSEKTFKDVSGTSQVSYTWSNAMLNWQRTAYHFQPQKNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAVSTDLIHWLYLPFAMVPDQWYDINGVWTGSATILPDGLIMMLYTGDTDDYVQVQNLAYPANLSDPLLL 226          
BLAST of CB290215 vs. ExPASy Swiss-Prot
Match: INV1_MAIZE (Beta-fructofuranosidase 1 OS=Zea mays GN=IVR1 PE=3 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.725e-55
Identity = 100/144 (69.44%), Postives = 115/144 (79.86%), Query Frame = 2
Query:  344 GVSEKSNRRFGSRTA--SYPWTNNMLSWQRTAFHFQPQKNWMNDPNGPVFYKGWYHLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGSATILSDGKLMMLYTGSTNE-SVQVQNLAYPADPSDPLL 766
            GVSEKS        A   + WTN ML+WQRTAFHFQP KNWMNDPNGP+++KGWYHLFYQ+NP+ A+WG+I WGHAVS+DL+HW HLPLAMV D  YD  GVW+GSAT L DG+++MLYTGST E S QVQNLA PAD SDPLL
Sbjct:   96 GVSEKSTAPLLGSGALQDFSWTNAMLAWQRTAFHFQPPKNWMNDPNGPLYHKGWYHLFYQWNPDSAVWGNITWGHAVSRDLLHWLHLPLAMVPDHPYDANGVWSGSATRLPDGRIVMLYTGSTAESSAQVQNLAEPADASDPLL 239          
BLAST of CB290215 vs. ExPASy Swiss-Prot
Match: GFT_ASPOF (6(G)-fructosyltransferase OS=Asparagus officinalis GN=FT1 PE=1 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 2.332e-52
Identity = 89/149 (59.73%), Postives = 113/149 (75.84%), Query Frame = 2
Query:  329 SASSAGVSEKSNRRFGSRTASYPWTNNMLSWQRTAFHFQPQKNWMNDPNGPVFYKGWYHLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGSATIL-SDGKLMMLYTGSTNESVQVQNLAYPADPSDPLLIK 772
            S SS      S  R GS    Y WTN ML+WQR  FHF+  KN+MNDP+GP++YKGWYHLFYQ+NPN A WGDI WGHAVS+DL++W+HLP+A+  D+WYDI GVWTGS T++  DG+++MLYTG T E  Q+ ++A  ADPSDPLL++
Sbjct:   36 SFSSRKSESGSGLRSGSVEPEYAWTNQMLTWQRAGFHFRTVKNYMNDPSGPMYYKGWYHLFYQHNPNYAYWGDISWGHAVSRDLLNWFHLPVAVKPDRWYDIYGVWTGSITVMPDDGRVVMLYTGGTKEKYQIMSVAMAADPSDPLLVE 184          
BLAST of CB290215 vs. ExPASy Swiss-Prot
Match: GFT_ALLCE (Bifunctional 6(G)-fructosyltransferase/2,1-fructan:2,1-fructan 1-fructosyltransferase OS=Allium cepa PE=1 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 3.853e-47
Identity = 78/127 (61.42%), Postives = 102/127 (80.31%), Query Frame = 2
Query:  392 YPWTNNMLSWQRTAFHFQPQKNWMNDPNGPVFYKGWYHLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGSATILSDGKLMMLYTGSTNESVQVQNLAYPADPSDPLLIK 772
            +PWTN+ML+WQR  FHF+  +N+MNDP+GP++YKGWYHLFYQ+N + A WG+I WGHAVS+DLI+W HLP+A+  D WYDI GVWTGS  ++S+ +++ML+TG T    Q  NLA  ADPSDPLL+K
Sbjct:   60 FPWTNDMLAWQRCGFHFRTVRNYMNDPSGPMYYKGWYHLFYQHNKDFAYWGNITWGHAVSRDLINWQHLPVAVGPDHWYDISGVWTGSIIVVSEDRVVMLFTGGTKSFDQSINLAEAADPSDPLLLK 186          
BLAST of CB290215 vs. ExPASy Swiss-Prot
Match: INV1_ORYSJ (Beta-fructofuranosidase, insoluble isoenzyme 1 OS=Oryza sativa subsp. japonica GN=CIN1 PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 9.511e-38
Identity = 71/116 (61.21%), Postives = 87/116 (75.00%), Query Frame = 2
Query:  425 RTAFHFQPQKNWMNDPNGPVFYKGWYHLFYQYNPNGAIWGDIVWGHAVSKDLIHWYHLPLAMVADQWYDIMGVWTGSATILSDGKLMMLYTG--STNESVQVQNLAYPADPSDPLL 766
            RT +HFQP  NW+NDPNGP++YKGWYHLFYQYNP GA+WG+IVW H+VS+DLI+W  L  A+  D   D  G W+GSATIL DG   +LYTG    N + QVQN+A+P + SDPLL
Sbjct:   49 RTGYHFQPPMNWINDPNGPLYYKGWYHLFYQYNPKGAVWGNIVWAHSVSQDLINWIALEPAIKPDIPSDQYGCWSGSATILPDGTPAILYTGIDRPNINYQVQNIAFPKNASDPLL 164          
The following BLAST results are available for this feature:
BLAST of CB290215 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 59
Match NameE-valueIdentityDescription
INVA_PHAAU3.239e-7070.91Acid beta-fructofuranosidase OS=Phaseolus aureus G... [more]
INVA_PHAVU1.231e-6977.03Acid beta-fructofuranosidase OS=Phaseolus vulgaris... [more]
INVA_VICFA2.742e-6973.21Acid beta-fructofuranosidase OS=Vicia faba GN=VCIN... [more]
INVB_DAUCA3.706e-6669.57Beta-fructofuranosidase, soluble isoenzyme I OS=Da... [more]
INVA_SOLLC2.248e-6372.19Acid beta-fructofuranosidase OS=Solanum lycopersic... [more]
INV1_CAPAN1.457e-6267.68Acid beta-fructofuranosidase AIV-18 OS=Capsicum an... [more]
INV1_MAIZE1.725e-5569.44Beta-fructofuranosidase 1 OS=Zea mays GN=IVR1 PE=3... [more]
GFT_ASPOF2.332e-5259.736(G)-fructosyltransferase OS=Asparagus officinalis... [more]
GFT_ALLCE3.853e-4761.42Bifunctional 6(G)-fructosyltransferase/2,1-fructan... [more]
INV1_ORYSJ9.511e-3861.21Beta-fructofuranosidase, insoluble isoenzyme 1 OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_01ab03_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01ab03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB290215 ID=CB290215|Name=CB290215|organism=Citrus sinensis|type=EST|length=774bp
GCCCTATGATTGAAACCAACAAATTTATCAAGCAGCAGCCCTCTAGTGCG
CCACATACATTCGTTAATCAATGGCAGATTCTAATGTATCCTACAATCCT
CTCCCGGACGGGGAACGTCCGCGGCCAACTCGCCGGAGATCCATCGTCTT
GGTTCTATCCGGTTTGTTGGTCGTTGGTTTTTTAGTTGCATTATTATCCG
ATAATGGATCAATAGCCCCTGCTAACGTTATTGATAATGACAATAATAAT
GTTAATGATAATGCAAAAAATGGGCTTAATGATGTGTCGTCGTCGTCGAA
AGAGCCCGAGAGACTCCGGCCGTTTACGAGTGCCTCGTCGGCCGGGGTGT
CTGAGAAGTCGAACCGGCGGTTTGGTTCAAGGACGGCGTCGTATCCCTGG
ACCAATAATATGCTGTCGTGGCAAAGGACCGCCTTCCACTTTCAACCCCA
AAAGAATTGGATGAATGATCCTAATGGTCCAGTGTTTTACAAAGGATGGT
ACCATTTGTTCTACCAGTACAACCCAAATGGCGCAATATGGGGTGACATA
GTGTGGGGGCATGCTGTGTCAAAGGACCTGATCCATTGGTATCACCTCCC
GTTGGCCATGGTTGCCGATCAATGGTATGATATTATGGGTGTCTGGACCG
GCTCTGCTACAATCCTATCTGATGGAAAACTTATGATGTTGTACACTGGA
TCCACCAACGAGTCTGTGCAGGTCCAAAATCTCGCATATCCTGCCGACCC
ATCTGATCCTCTCCTCATCAAATG
back to top