CB290275

Overview
NameCB290275
Unique NameCB290275
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length767
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12567 contig Csv1_Contig12567:828..1593. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB290275 vs. ExPASy Swiss-Prot
Match: THI4_CITSI (Thiazole biosynthetic enzyme, chloroplastic OS=Citrus sinensis GN=THI1 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 7.705e-64
Identity = 123/124 (99.19%), Postives = 124/124 (100.00%), Query Frame = -1
Query:  393 EVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD 764
            +VVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD
Sbjct:  232 KVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD 355          
BLAST of CB290275 vs. ExPASy Swiss-Prot
Match: THI4_ALNGL (Thiazole biosynthetic enzyme, chloroplastic OS=Alnus glutinosa GN=THI4 PE=2 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.662e-58
Identity = 112/124 (90.32%), Postives = 119/124 (95.97%), Query Frame = -1
Query:  393 EVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD 764
            +VVVSSCGHDGPFGATGVK L+SIGMI+ VPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG PNALDG+YVGG+HPELILAAADSAE AD
Sbjct:  228 KVVVSSCGHDGPFGATGVKSLRSIGMIDTVPGMKALDMNVAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIHPELILAAADSAEIAD 351          
BLAST of CB290275 vs. ExPASy Swiss-Prot
Match: THI4_ARATH (Thiazole biosynthetic enzyme, chloroplastic OS=Arabidopsis thaliana GN=THI1 PE=1 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 4.527e-56
Identity = 108/124 (87.10%), Postives = 116/124 (93.55%), Query Frame = -1
Query:  393 EVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD 764
            ++VVSSCGHDGPFGATGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA  LALK+LG PNA+DGT VG + PEL+LAAADSAET D
Sbjct:  225 KIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPELVLAAADSAETVD 348          
BLAST of CB290275 vs. ExPASy Swiss-Prot
Match: THI41_MAIZE (Thiazole biosynthetic enzyme 1-1, chloroplastic OS=Zea mays GN=THI1-1 PE=2 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 9.144e-49
Identity = 97/118 (82.20%), Postives = 106/118 (89.83%), Query Frame = -1
Query:  411 EVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAAD 764
            +VVVSSCGHDGPFGATGVKRL+ IGMI  VPGMKALDMN+AED IVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNA+DGT    +  EL++A  D
Sbjct:  231 KVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTMSPPLREELMIAYKD 348          
BLAST of CB290275 vs. ExPASy Swiss-Prot
Match: THI42_MAIZE (Thiazole biosynthetic enzyme 1-2, chloroplastic OS=Zea mays GN=THI1-2 PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.320e-47
Identity = 98/122 (80.33%), Postives = 108/122 (88.52%), Query Frame = -1
Query:  411 EVVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHP----ELILAAAD 764
            +VVVSSCGHDGPFGATGVKRL+ IGMI  VPGMKALDMN+AED IVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNA+DGT +  V P    E ++A+ D
Sbjct:  228 KVVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNAAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGT-IPEVSPALREEFVIASKD 348          
BLAST of CB290275 vs. ExPASy Swiss-Prot
Match: THI4_FUSSH (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium solani subsp. phaseoli GN=STI35 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 7.532e-27
Identity = 60/91 (65.93%), Postives = 75/91 (82.42%), Query Frame = -1
Query:  489 VVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK 761
            +V+S+ GHD P GA  VKRL S+G IE++ GM+ LDMN AEDAIV+ TRE+VPG+IV GME++E+DGA RMGPTFGAM++SG KAA  ALK
Sbjct:  223 LVISTTGHDAPMGAFCVKRLVSMGRIEKLGGMRGLDMNVAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMVLSGLKAAEEALK 313          
BLAST of CB290275 vs. ExPASy Swiss-Prot
Match: THI4_ASPOR (Thiazole biosynthetic enzyme, mitochondrial OS=Aspergillus oryzae GN=thiA PE=3 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 2.192e-26
Identity = 58/91 (63.74%), Postives = 74/91 (81.32%), Query Frame = -1
Query:  489 VVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK 761
            V++S+ GHDGPFGA   KRL S+G ++++ GM+ LDMNSAEDAIV+ TREV  G+I+ GME++EIDG  RMGPTFGAM++SG KAA  ALK
Sbjct:  226 VIISTTGHDGPFGAFCAKRLVSMGSVDKLGGMRGLDMNSAEDAIVKNTREVTKGLIIGGMELSEIDGFNRMGPTFGAMVLSGVKAAEEALK 316          
BLAST of CB290275 vs. ExPASy Swiss-Prot
Match: THI4_FUSOX (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium oxysporum GN=STI35 PE=2 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 2.862e-26
Identity = 59/91 (64.84%), Postives = 74/91 (81.32%), Query Frame = -1
Query:  489 VVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK 761
            +++S+ GHDGP GA  VKRL S+  IE++ GM+ LDMN AEDAIV+ TRE+VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK
Sbjct:  219 LIISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNLAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALK 309          
BLAST of CB290275 vs. ExPASy Swiss-Prot
Match: THI4_UROFA (Thiazole biosynthetic enzyme, mitochondrial OS=Uromyces fabae GN=THI2 PE=3 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 5.398e-25
Identity = 57/105 (54.29%), Postives = 76/105 (72.38%), Query Frame = -1
Query:  447 VVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVG 761
            +V S  GHDGPFGA  VKR+ S G+ E +  M+ LDM  AED I   TRE++PG+IV GME++E DG+ RMGPTFGAM++SG++AA +AL+SL +    +G  VG
Sbjct:  231 LVCSFAGHDGPFGAFCVKRVASAGLSEGLGDMRPLDMERAEDHIANKTREILPGLIVGGMELSEFDGSARMGPTFGAMLLSGKRAAEVALQSLDRVKIEEGEVVG 335          
BLAST of CB290275 vs. ExPASy Swiss-Prot
Match: THI2_SCHPO (Thiazole biosynthetic enzyme, mitochondrial OS=Schizosaccharomyces pombe GN=thi2 PE=2 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 7.050e-25
Identity = 60/104 (57.69%), Postives = 73/104 (70.19%), Query Frame = -1
Query:  450 VVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYV 761
            +VVS+ GHDGPFGA  VKRL S  ++  +  M+ LDMN AED IV+ TREV PGMIV GME++E DGA RMGPTFG MM SG KAA  AL    +  A++  Y+
Sbjct:  225 LVVSATGHDGPFGAFCVKRLASAQLVSNLHDMRPLDMNRAEDLIVKGTREVFPGMIVGGMELSEFDGANRMGPTFGGMMFSGIKAAQEALAIFDERKAVNEKYL 328          
The following BLAST results are available for this feature:
BLAST of CB290275 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
THI4_CITSI7.705e-6499.19Thiazole biosynthetic enzyme, chloroplastic OS=Cit... [more]
THI4_ALNGL1.662e-5890.32Thiazole biosynthetic enzyme, chloroplastic OS=Aln... [more]
THI4_ARATH4.527e-5687.10Thiazole biosynthetic enzyme, chloroplastic OS=Ara... [more]
THI41_MAIZE9.144e-4982.20Thiazole biosynthetic enzyme 1-1, chloroplastic OS... [more]
THI42_MAIZE1.320e-4780.33Thiazole biosynthetic enzyme 1-2, chloroplastic OS... [more]
THI4_FUSSH7.532e-2765.93Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_ASPOR2.192e-2663.74Thiazole biosynthetic enzyme, mitochondrial OS=Asp... [more]
THI4_FUSOX2.862e-2664.84Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_UROFA5.398e-2554.29Thiazole biosynthetic enzyme, mitochondrial OS=Uro... [more]
THI2_SCHPO7.050e-2557.69Thiazole biosynthetic enzyme, mitochondrial OS=Sch... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_01ae05_b1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01ae05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB290275 ID=CB290275|Name=CB290275|organism=Citrus sinensis|type=EST|length=767bp
CCCACTANTTTTTTTTTCATTTTTTTGATCTTAATCACATCAGCACTGTC
CCATTGGGCTGATGCCTCAAGTTATAAACATACAAAGCAAAGAAAAGGGA
ACAGCCCAAGGGCAGTCTTACACATAATACAGATAACAAGGACTAGATAC
GCAACTGCAAATTCACCCCCGAAAAACTCACAACGGTTTCTTACAAGAGG
AGAAAGAAATTAAAATTAAAGGTTGCATGATGGACCGGAAACAAACACTT
TATTCACAAAACCTCACAACATCATCTCATTATTCGCATCAACCATCCAT
CACAACCACCTAAATACAACTACTTTTTTGCCAGAGTTTATTTGCATGCA
CACAGCTGATGAGTGATGATGCCTGTTATTATCAAATTAACCATCAGCAG
TCTCAGCAGAATCAGCTGCAGCTAAGATCAGCTCAGGGTGAACACCTCCC
ACATATGTACCGTCTAATGCATTCGGCTGGCCCAGTGACTTCAACGCCAA
ATGCGCAGCCTTCTGCCCCGATATCATCATTGCTCCAAATGTTGGCCCCA
TTCTAGGAGCACCATCAATCTCGGCAACTTCCATGCCGGTAACTATCATA
CCAGGCACAACCTCCCTGGTCAGCCTCACAATAGCATCTTCTGCAGAGTT
CATGTCCAGTGCCTTCATTCCAGGCACTTCCTCAATCATTCCGATACTCT
TCAACCTCTTTACTCCAGTGGCCCCAAAAGGCCCATCATGGCCACAAGAG
CTCACAACCACCTCGTG
back to top