CB290276

Overview
NameCB290276
Unique NameCB290276
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length739
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12567 contig Csv1_Contig12567:827..1565. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB290276 vs. ExPASy Swiss-Prot
Match: THI4_CITSI (Thiazole biosynthetic enzyme, chloroplastic OS=Citrus sinensis GN=THI1 PE=2 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 7.975e-63
Identity = 122/123 (99.19%), Postives = 122/123 (99.19%), Query Frame = 2
Query:    8 VVVSSCGHDGPSGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD 376
            VVVSSCGHDGP GATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD
Sbjct:  233 VVVSSCGHDGPFGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD 355          
BLAST of CB290276 vs. ExPASy Swiss-Prot
Match: THI4_ALNGL (Thiazole biosynthetic enzyme, chloroplastic OS=Alnus glutinosa GN=THI4 PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.721e-57
Identity = 111/123 (90.24%), Postives = 117/123 (95.12%), Query Frame = 2
Query:    8 VVVSSCGHDGPSGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD 376
            VVVSSCGHDGP GATGVK L+SIGMI+ VPGMKALDMN AEDAIVRLTRE+VPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG PNALDG+YVGG+HPELILAAADSAE AD
Sbjct:  229 VVVSSCGHDGPFGATGVKSLRSIGMIDTVPGMKALDMNVAEDAIVRLTREIVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIHPELILAAADSAEIAD 351          
BLAST of CB290276 vs. ExPASy Swiss-Prot
Match: THI4_ARATH (Thiazole biosynthetic enzyme, chloroplastic OS=Arabidopsis thaliana GN=THI1 PE=1 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 4.686e-55
Identity = 107/123 (86.99%), Postives = 114/123 (92.68%), Query Frame = 2
Query:    8 VVVSSCGHDGPSGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAADSAETAD 376
            +VVSSCGHDGP GATGVKRLKSIGMI+ VPGMKALDMN+AEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKA  LALK+LG PNA+DGT VG + PEL+LAAADSAET D
Sbjct:  226 IVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPELVLAAADSAETVD 348          
BLAST of CB290276 vs. ExPASy Swiss-Prot
Match: THI41_MAIZE (Thiazole biosynthetic enzyme 1-1, chloroplastic OS=Zea mays GN=THI1-1 PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 9.464e-48
Identity = 96/117 (82.05%), Postives = 104/117 (88.89%), Query Frame = 2
Query:    8 VVVSSCGHDGPSGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELILAAAD 358
            VVVSSCGHDGP GATGVKRL+ IGMI  VPGMKALDMN+AED IVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNA+DGT    +  EL++A  D
Sbjct:  232 VVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNTAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGTMSPPLREELMIAYKD 348          
BLAST of CB290276 vs. ExPASy Swiss-Prot
Match: THI42_MAIZE (Thiazole biosynthetic enzyme 1-2, chloroplastic OS=Zea mays GN=THI1-2 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.367e-46
Identity = 97/121 (80.17%), Postives = 106/121 (87.60%), Query Frame = 2
Query:    8 VVVSSCGHDGPSGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHP----ELILAAAD 358
            VVVSSCGHDGP GATGVKRL+ IGMI  VPGMKALDMN+AED IVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK+LG+PNA+DGT +  V P    E ++A+ D
Sbjct:  229 VVVSSCGHDGPFGATGVKRLQDIGMISAVPGMKALDMNAAEDEIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKALGRPNAVDGT-IPEVSPALREEFVIASKD 348          
BLAST of CB290276 vs. ExPASy Swiss-Prot
Match: THI4_FUSSH (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium solani subsp. phaseoli GN=STI35 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 9.209e-27
Identity = 60/91 (65.93%), Postives = 75/91 (82.42%), Query Frame = 2
Query:    8 VVVSSCGHDGPSGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK 280
            +V+S+ GHD P GA  VKRL S+G IE++ GM+ LDMN AEDAIV+ TRE+VPG+IV GME++E+DGA RMGPTFGAM++SG KAA  ALK
Sbjct:  223 LVISTTGHDAPMGAFCVKRLVSMGRIEKLGGMRGLDMNVAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMVLSGLKAAEEALK 313          
BLAST of CB290276 vs. ExPASy Swiss-Prot
Match: THI4_FUSOX (Thiazole biosynthetic enzyme, mitochondrial OS=Fusarium oxysporum GN=STI35 PE=2 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 3.500e-26
Identity = 59/91 (64.84%), Postives = 74/91 (81.32%), Query Frame = 2
Query:    8 VVVSSCGHDGPSGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK 280
            +++S+ GHDGP GA  VKRL S+  IE++ GM+ LDMN AEDAIV+ TRE+VPG+IV GME++E+DGA RMGPTFGAM +SG KAA  ALK
Sbjct:  219 LIISTTGHDGPMGAFCVKRLVSMQRIEKLGGMRGLDMNLAEDAIVKGTREIVPGLIVGGMELSEVDGANRMGPTFGAMALSGLKAAEEALK 309          
BLAST of CB290276 vs. ExPASy Swiss-Prot
Match: THI4_ASPOR (Thiazole biosynthetic enzyme, mitochondrial OS=Aspergillus oryzae GN=thiA PE=3 SV=2)

HSP 1 Score: 116.316 bits (290), Expect = 1.737e-25
Identity = 57/91 (62.64%), Postives = 73/91 (80.22%), Query Frame = 2
Query:    8 VVVSSCGHDGPSGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALK 280
            V++S+ GHDGP GA   KRL S+G ++++ GM+ LDMNSAEDAIV+ TREV  G+I+ GME++EIDG  RMGPTFGAM++SG KAA  ALK
Sbjct:  226 VIISTTGHDGPFGAFCAKRLVSMGSVDKLGGMRGLDMNSAEDAIVKNTREVTKGLIIGGMELSEIDGFNRMGPTFGAMVLSGVKAAEEALK 316          
BLAST of CB290276 vs. ExPASy Swiss-Prot
Match: THI4_UROFA (Thiazole biosynthetic enzyme, mitochondrial OS=Uromyces fabae GN=THI2 PE=3 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 4.278e-24
Identity = 56/105 (53.33%), Postives = 75/105 (71.43%), Query Frame = 2
Query:    8 VVVSSCGHDGPSGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYVG 322
            +V S  GHDGP GA  VKR+ S G+ E +  M+ LDM  AED I   TRE++PG+IV GME++E DG+ RMGPTFGAM++SG++AA +AL+SL +    +G  VG
Sbjct:  231 LVCSFAGHDGPFGAFCVKRVASAGLSEGLGDMRPLDMERAEDHIANKTREILPGLIVGGMELSEFDGSARMGPTFGAMLLSGKRAAEVALQSLDRVKIEEGEVVG 335          
BLAST of CB290276 vs. ExPASy Swiss-Prot
Match: THI2_SCHPO (Thiazole biosynthetic enzyme, mitochondrial OS=Schizosaccharomyces pombe GN=thi2 PE=2 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 5.587e-24
Identity = 59/104 (56.73%), Postives = 72/104 (69.23%), Query Frame = 2
Query:    8 VVVSSCGHDGPSGATGVKRLKSIGMIEEVPGMKALDMNSAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAAHLALKSLGQPNALDGTYV 319
            +VVS+ GHDGP GA  VKRL S  ++  +  M+ LDMN AED IV+ TREV PGMIV GME++E DGA RMGPTFG MM SG KAA  AL    +  A++  Y+
Sbjct:  225 LVVSATGHDGPFGAFCVKRLASAQLVSNLHDMRPLDMNRAEDLIVKGTREVFPGMIVGGMELSEFDGANRMGPTFGGMMFSGIKAAQEALAIFDERKAVNEKYL 328          
The following BLAST results are available for this feature:
BLAST of CB290276 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
THI4_CITSI7.975e-6399.19Thiazole biosynthetic enzyme, chloroplastic OS=Cit... [more]
THI4_ALNGL1.721e-5790.24Thiazole biosynthetic enzyme, chloroplastic OS=Aln... [more]
THI4_ARATH4.686e-5586.99Thiazole biosynthetic enzyme, chloroplastic OS=Ara... [more]
THI41_MAIZE9.464e-4882.05Thiazole biosynthetic enzyme 1-1, chloroplastic OS... [more]
THI42_MAIZE1.367e-4680.17Thiazole biosynthetic enzyme 1-2, chloroplastic OS... [more]
THI4_FUSSH9.209e-2765.93Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_FUSOX3.500e-2664.84Thiazole biosynthetic enzyme, mitochondrial OS=Fus... [more]
THI4_ASPOR1.737e-2562.64Thiazole biosynthetic enzyme, mitochondrial OS=Asp... [more]
THI4_UROFA4.278e-2453.33Thiazole biosynthetic enzyme, mitochondrial OS=Uro... [more]
THI2_SCHPO5.587e-2456.73Thiazole biosynthetic enzyme, mitochondrial OS=Sch... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_01ae05_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01ae05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB290276 ID=CB290276|Name=CB290276|organism=Citrus sinensis|type=EST|length=739bp
GCCCGTGGTGGTTGTGAGCTCTTGTGGCCATGATGGGCCTTCTGGGGCCA
CTGGAGTAAAGAGGTTGAAGAGTATCGGAATGATTGAGGAAGTGCCTGGA
ATGAAGGCACTGGACATGAACTCTGCAGAAGATGCTATTGTGAGGCTGAC
CAGGGAGGTTGTGCCTGGTATGATAGTTACCGGCATGGAAGTTGCCGAGA
TTGATGGTGCTCCTAGAATGGGGCCAACATTTGGAGCAATGATGATATCG
GGGCAGAAGGCTGCGCATTTGGCGTTGAAGTCACTGGGCCAGCCGAATGC
ATTAGACGGTACATATGTGGGAGGTGTTCACCCTGAGCTGATCTTAGCTG
CAGCTGATTCTGCTGAGACTGCTGATGGTTAATTTGATAATAACAGGCAT
CATCACTCATCAGCTGTGTGCATGCAAATAAACTCTGGCAAAAAAGTAGT
TGTATTTAGGTGGTTGTGATGGATGGTTGATGCGAATAATGAGATGATGT
TGTGAGGTTTTGTGAATAAAGTGTTTGTTTCCGGTCCATCATGCAACCTT
TAATTTTAATTTCTTTCTCCTCTTGTAAGAAACCGTTGTGAGTTTTTCGG
GGGTGAATTTGCAGTTGCGTATCTAGTCCTTGTTATCTGTATTATGTGTA
AGACTGCCCTTGGGCTGTTCCCTTTTCTTTGCTTTGTATGTTTATAACTT
GAGGCATCAGCCAATGGGACAGTGCTGATGTGATTAAGA
back to top