CB290278

Overview
NameCB290278
Unique NameCB290278
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length783
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig365 contig Csv1_Contig365:298..1080. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB290278 vs. ExPASy Swiss-Prot
Match: MAOX_POPTR (NADP-dependent malic enzyme OS=Populus trichocarpa PE=2 SV=3)

HSP 1 Score: 456.833 bits (1174), Expect = 5.971e-128
Identity = 221/246 (89.84%), Postives = 236/246 (95.93%), Query Frame = 1
Query:   46 MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRVTEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTKHEQLLKDEFYI 783
            MEST+KEMRDGASVLD D KSTV GGVEDVYGEDR TEDQLVTPWTISVASGY LLRDP HNKGLAFTEKERDAHYLRGLLPP  ISQQLQEKKLMN+IRQY++PLQKY AMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIF+RPQGLYISLKEKGK+L+VLKNWP++SIQVIVVTDGERILGLGDLGCQG+GIPVGKL+LYTALGG+RPSACLP+T+DVGT +EQLLKDEFYI
Sbjct:    1 MESTLKEMRDGASVLDMDPKSTVGGGVEDVYGEDRATEDQLVTPWTISVASGYTLLRDPHHNKGLAFTEKERDAHYLRGLLPPTTISQQLQEKKLMNTIRQYQLPLQKYTAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFKRPQGLYISLKEKGKVLDVLKNWPQKSIQVIVVTDGERILGLGDLGCQGIGIPVGKLSLYTALGGVRPSACLPVTIDVGTNNEQLLKDEFYI 246          
BLAST of CB290278 vs. ExPASy Swiss-Prot
Match: MAOX_VITVI (NADP-dependent malic enzyme OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 439.499 bits (1129), Expect = 9.865e-123
Identity = 213/246 (86.59%), Postives = 233/246 (94.72%), Query Frame = 1
Query:   46 MESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRVTEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTKHEQLLKDEFYI 783
            MEST+K++RDGASVLD D K+TV GGVED+YGED  TEDQLVTPWT+SVASGY LLRDPRHNKGLAF +KERDAHYL GLLPP V +Q+LQE+KLMNSIRQY+VPLQKY+AMM+L+ERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPER IQVIVVTDGERILGLGDLGCQGMGIPVGKL+LYTALGG+RPSACLPIT+DVGT +E+LL +EFYI
Sbjct:    1 MESTLKDIRDGASVLDLDPKATVGGGVEDLYGEDFATEDQLVTPWTVSVASGYSLLRDPRHNKGLAFNDKERDAHYLCGLLPPVVSTQELQERKLMNSIRQYQVPLQKYMAMMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERRIQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGVRPSACLPITIDVGTNNEKLLANEFYI 246          
BLAST of CB290278 vs. ExPASy Swiss-Prot
Match: MAOC_FLAPR (NADP-dependent malic enzyme, chloroplastic OS=Flaveria pringlei GN=MODA PE=2 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 1.634e-109
Identity = 189/260 (72.69%), Postives = 224/260 (86.15%), Query Frame = 1
Query:   19 KAEKVKRVPMESTMKEMRDGASVLDFDSKS-----TVEGGVEDVYGEDRVTEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTKHEQLLKDEFYI 783
            + E+   V ++  +K++    +V   DS+S      V GGVEDVYGED  TED  +TPW++SVASGY LLRDP HNKGLAFTEKERDAHYLRGLLPP V++  LQ KK+M++IRQYEVPLQ+Y AMM+L+ERNERLFYKLLI+N+EELLP+VYTPTVGEACQKYG+IF+ PQGLYISLK+KGK+LE+LKNWP++ IQVIVVTDGERILGLGDLGCQGMGIPVGKL+LYTALGGIRPSACLPIT+DVGT +E++L DEFYI
Sbjct:   43 RPERSVGVSVDGAVKDVNAPVAVEVADSESKKPTAVVGGGVEDVYGEDSATEDHFITPWSVSVASGYSLLRDPHHNKGLAFTEKERDAHYLRGLLPPVVVNHDLQVKKMMHNIRQYEVPLQRYQAMMDLQERNERLFYKLLIENIEELLPIVYTPTVGEACQKYGTIFKNPQGLYISLKDKGKVLEILKNWPQKKIQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGIRPSACLPITIDVGTNNEKMLNDEFYI 302          
BLAST of CB290278 vs. ExPASy Swiss-Prot
Match: MAOX_PHAVU (NADP-dependent malic enzyme OS=Phaseolus vulgaris GN=ME1 PE=2 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.059e-108
Identity = 186/222 (83.78%), Postives = 209/222 (94.14%), Query Frame = 1
Query:  118 GGVEDVYGEDRVTEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTKHEQLLKDEFYI 783
            GGV D+YGED  TED L+TPWT SVASG  LLRDPR+NKGLAFTE ERDAHYLRGLLPP+V +Q+LQEK+LM+++RQYEVPL +Y+A+M+L+ERNERLFYKLLIDNV ELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPE+SIQVIVVTDGERILGLGDLGCQGMGIPVGKL+LYTALGG+RPS+CLP+T+DVGT +E+LL DEFYI
Sbjct:   23 GGVRDLYGEDSATEDHLITPWTFSVASGCSLLRDPRYNKGLAFTEGERDAHYLRGLLPPSVFNQELQEKRLMHNLRQYEVPLHRYMALMDLQERNERLFYKLLIDNVAELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPEKSIQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGVRPSSCLPVTIDVGTNNEKLLNDEFYI 244          
BLAST of CB290278 vs. ExPASy Swiss-Prot
Match: MAOC_ORYSJ (NADP-dependent malic enzyme, chloroplastic OS=Oryza sativa subsp. japonica GN=ME6 PE=2 SV=2)

HSP 1 Score: 380.178 bits (975), Expect = 7.102e-105
Identity = 187/252 (74.21%), Postives = 216/252 (85.71%), Query Frame = 1
Query:   28 KVKRVPMESTMKEMRDGASVLDFDSKSTVEGGVEDVYGEDRVTEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTKHEQLLKDEFYI 783
            +V+ V MES  +  +        +  +   GGVED+      TE+  VTPW  SVASGY LLRDP HNKGLAF+EKERDAHYLRGLLPPAV+SQ LQ KK+M+++RQY VPLQ+Y+AMM+L+ERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFR+PQGLY+SLK+KGK+L+VL+NWPER+IQVIVVTDGERILGLGDLGCQGMGIPVGKL+LYTALGG+RPSACLPIT+DVGT +EQLL DEFYI
Sbjct:   55 RVEAVAMESAAETEKK-------EEVAAAGGGVEDM-----ATEEVPVTPWAFSVASGYTLLRDPHHNKGLAFSEKERDAHYLRGLLPPAVVSQDLQVKKIMHNLRQYSVPLQRYMAMMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRQPQGLYVSLKDKGKVLDVLRNWPERNIQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGVRPSACLPITIDVGTNNEQLLNDEFYI 294          
BLAST of CB290278 vs. ExPASy Swiss-Prot
Match: MAOX_MESCR (NADP-dependent malic enzyme OS=Mesembryanthemum crystallinum GN=MOD1 PE=2 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 1.582e-104
Identity = 176/224 (78.57%), Postives = 209/224 (93.30%), Query Frame = 1
Query:  112 VEGGVEDVYGEDRVTEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTKHEQLLKDEFYI 783
            + GGV DVYGE+  T+DQLVTPW+ SVA G+ LLRDP+HNKGLAFTEKERDAH+LRGLLPP V+SQ+LQEKK + ++RQY+VPLQKY+AMM+L+ERNE+LFYKLL+D+VEELLP+VYTPTVGE CQKYGSIFRRPQGL+ISLK+KG+ILE+L+NWPE+ IQVIVVTDGERILGLGDLGCQGMGIPVGKL+LY+ALGG+ PSACLPIT+DVGT +++LL DEFYI
Sbjct:   17 ITGGVADVYGEEFATQDQLVTPWSFSVACGHSLLRDPQHNKGLAFTEKERDAHFLRGLLPPVVLSQELQEKKFLTTLRQYQVPLQKYMAMMDLQERNEKLFYKLLVDHVEELLPLVYTPTVGEGCQKYGSIFRRPQGLFISLKDKGRILELLRNWPEKKIQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYSALGGVCPSACLPITLDVGTNNQKLLDDEFYI 240          
BLAST of CB290278 vs. ExPASy Swiss-Prot
Match: MAOC_FLATR (NADP-dependent malic enzyme, chloroplastic OS=Flaveria trinervia GN=MOD1 PE=2 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 2.067e-104
Identity = 179/227 (78.85%), Postives = 206/227 (90.75%), Query Frame = 1
Query:  106 STVEGGVEDVYGEDRVTEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTKHEQLLK-DEFYI 783
            + V GGVED+YGED  TED  +TPW++SVASGY LLRDP HNKGLAFTEKERDAH+LRGLLPP V++  LQ KK+M++IRQY+VPLQ+Y AMM+L++RNERLFYKLLI+NVEELLP+VYTPTVGEACQKYGSIF   QGL+ISLK+KG+ILE+LKNWP + IQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGG+RPSACLPIT+DVGT +E+LL  DEFYI
Sbjct:   77 AAVGGGVEDMYGEDTATEDHYITPWSVSVASGYSLLRDPHHNKGLAFTEKERDAHFLRGLLPPVVVNHDLQVKKMMHNIRQYQVPLQRYQAMMDLQQRNERLFYKLLIENVEELLPIVYTPTVGEACQKYGSIFENSQGLFISLKDKGRILEILKNWPHKKIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGVRPSACLPITIDVGTNNEKLLNDDEFYI 303          
BLAST of CB290278 vs. ExPASy Swiss-Prot
Match: MAOC_SOLLC (NADP-dependent malic enzyme, chloroplastic (Fragment) OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 6.648e-103
Identity = 179/227 (78.85%), Postives = 206/227 (90.75%), Query Frame = 1
Query:  103 KSTVEGGVEDVYGEDRVTEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTKHEQLLKDEFYI 783
            +STV GGV+DVYGED  TEDQ +TPWT+SVASG+ LLR+P +NKGLAF+E+ERD HYLRGLLPP VIS  LQ KK+MNSIR+Y+VPLQ+Y+AMM+L+E NERLFYKLLIDNVEELLP+VYTPTVGEACQKYG IF+RPQGL+ SLKEKGKI EVLKNWPE+ IQVIVVTDGERILGLGDLGCQGMGIPVGKL+LY+ALGGIRPSACLP+T+DVG +  + + DEFYI
Sbjct:    4 ESTVTGGVQDVYGEDSATEDQSITPWTLSVASGFSLLRNPHYNKGLAFSERERDTHYLRGLLPPVVISHDLQVKKMMNSIRKYDVPLQRYMAMMDLQEMNERLFYKLLIDNVEELLPIVYTPTVGEACQKYGWIFKRPQGLFFSLKEKGKIHEVLKNWPEKKIQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYSALGGIRPSACLPVTIDVG-QTMKFVDDEFYI 229          
BLAST of CB290278 vs. ExPASy Swiss-Prot
Match: MAOC_MAIZE (NADP-dependent malic enzyme, chloroplastic OS=Zea mays GN=MOD1 PE=1 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 6.027e-96
Identity = 167/210 (79.52%), Postives = 187/210 (89.05%), Query Frame = 1
Query:  154 TEDQLVTPWTISVASGYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTKHEQLLKDEFYI 783
            +E+  V PW  SVASGY LLRDP HNKGLAFTE+ERD HYLRGLLPPAV+SQ+LQ KK MN++RQY+ PLQ+Y+AMM L+E +ERLFYKLLIDNV ELLP VYTPTVGEACQKYGSIF RPQGLY+SLK+KGK+LEVL+NWP R+IQVI VTDGERILGLGDLGCQGMGIPVGKLALYTALGG+ PS CLPIT+DVGT +E LL DEFYI
Sbjct:   82 SEELPVMPWATSVASGYTLLRDPHHNKGLAFTEEERDGHYLRGLLPPAVLSQELQIKKFMNTLRQYQTPLQRYIAMMNLQETDERLFYKLLIDNVVELLPFVYTPTVGEACQKYGSIFGRPQGLYVSLKDKGKVLEVLRNWPHRNIQVICVTDGERILGLGDLGCQGMGIPVGKLALYTALGGVDPSVCLPITIDVGTNNEFLLNDEFYI 291          
BLAST of CB290278 vs. ExPASy Swiss-Prot
Match: MAOX_MOUSE (NADP-dependent malic enzyme OS=Mus musculus GN=Me1 PE=1 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 1.038e-63
Identity = 113/195 (57.95%), Postives = 148/195 (75.90%), Query Frame = 1
Query:  199 GYCLLRDPRHNKGLAFTEKERDAHYLRGLLPPAVISQQLQEKKLMNSIRQYEVPLQKYVAMMELEERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLALYTALGGIRPSACLPITVDVGTKHEQLLKDEFYI 783
            GY L RDP  NK LAFT +ER    + GLLPP +ISQ+LQ  +++ +  +      +Y+ +M+L++RNE+LFY +L+ +VE+ +P+VYTPTVG ACQ+Y   FR+P+GL+IS+ +KG I  VL  WPE  ++ IVVTDGERILGLGDLGC GMGIPVGKLALYTA GG+ P  CLPIT+DVGT++E+LLKD  YI
Sbjct:   15 GYLLTRDPHLNKDLAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERLNSDFDRYLLLMDLQDRNEKLFYSVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDKGHIASVLNAWPEDVVKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKDPLYI 209          
The following BLAST results are available for this feature:
BLAST of CB290278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 140
Match NameE-valueIdentityDescription
MAOX_POPTR5.971e-12889.84NADP-dependent malic enzyme OS=Populus trichocarpa... [more]
MAOX_VITVI9.865e-12386.59NADP-dependent malic enzyme OS=Vitis vinifera PE=2... [more]
MAOC_FLAPR1.634e-10972.69NADP-dependent malic enzyme, chloroplastic OS=Flav... [more]
MAOX_PHAVU1.059e-10883.78NADP-dependent malic enzyme OS=Phaseolus vulgaris ... [more]
MAOC_ORYSJ7.102e-10574.21NADP-dependent malic enzyme, chloroplastic OS=Oryz... [more]
MAOX_MESCR1.582e-10478.57NADP-dependent malic enzyme OS=Mesembryanthemum cr... [more]
MAOC_FLATR2.067e-10478.85NADP-dependent malic enzyme, chloroplastic OS=Flav... [more]
MAOC_SOLLC6.648e-10378.85NADP-dependent malic enzyme, chloroplastic (Fragme... [more]
MAOC_MAIZE6.027e-9679.52NADP-dependent malic enzyme, chloroplastic OS=Zea ... [more]
MAOX_MOUSE1.038e-6357.95NADP-dependent malic enzyme OS=Mus musculus GN=Me1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_01ae06_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01ae06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB290278 ID=CB290278|Name=CB290278|organism=Citrus sinensis|type=EST|length=783bp
GCCCTTGGGTTTTTGTGAAAAGCAGAAAAAGTAAAAAGAGTGCCAATGGA
GAGCACCATGAAGGAGATGAGAGACGGAGCTTCGGTTCTCGACTTCGACT
CGAAATCCACCGTCGAAGGCGGCGTTGAAGACGTCTACGGTGAGGATCGT
GTCACCGAGGACCAGCTCGTCACTCCCTGGACCATCTCTGTTGCCAGCGG
GTACTGTTTGTTGAGGGATCCACGCCATAACAAAGGGCTTGCTTTCACTG
AGAAAGAGAGGGATGCCCACTACTTGCGCGGCCTTTTGCCTCCAGCTGTT
ATAAGTCAACAACTTCAGGAGAAGAAATTGATGAACAGCATCAGACAATA
TGAAGTTCCGCTGCAAAAATATGTGGCCATGATGGAACTTGAGGAGAGAA
ATGAAAGACTGTTCTATAAGCTACTGATTGATAATGTTGAGGAACTTCTC
CCAGTCGTTTACACTCCAACTGTTGGTGAAGCTTGCCAGAAATATGGAAG
TATCTTCAGGCGTCCTCAGGGTCTATACATAAGTCTGAAAGAGAAGGGAA
AGATTCTTGAGGTTTTGAAGAACTGGCCTGAAAGGAGTATTCAGGTTATT
GTTGTCACAGATGGTGAGCGCATTTTGGGACTTGGGGATCTTGGCTGTCA
GGGGATGGGAATTCCTGTTGGGAAATTGGCTTTGTACACAGCACTTGGAG
GCATTCGTCCCTCAGCATGTTTGCCCATAACCGTTGATGTGGGTACAAAA
CATGAGCAATTGTTGAAGGATGAATTCTACATT
back to top