CB290290

Overview
NameCB290290
Unique NameCB290290
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length721
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB290290 vs. ExPASy Swiss-Prot
Match: APMAP_HUMAN (Adipocyte plasma membrane-associated protein OS=Homo sapiens GN=APMAP PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 9.697e-34
Identity = 89/242 (36.78%), Postives = 130/242 (53.72%), Query Frame = -1
Query:   17 GLLKVGP---EGGLATAVATQSEGIPFRFCNSLDIDQSTGIIYFTDSSSQFQRRNHISVILSGDKTGRLMKYDPATKQVTVFLGNLSFPNGVALSEDGNYILLAETTSCRILRYWLK-TSKAGTIEIVAQLPGFPDNIKRSPRGGFWVGIHSRRKGIFKLVLSF----PWIGNVLIKLPIDIVKIHSSLVKLSGNGGMAMRISDQGNVLEILEEIGRKMWRSISEVEGKDGNLWIGSVNMPY 718
            GL +V P   E  L  +  T  EG    F N L + Q    IYFTDSSS++QRR+++ +++ G   GRL++YD  T++V V L  L FPNGV LS   +++L+AETT  RI R ++    K G    V  +PGFPDNI+ S  GG+WVG+ + R      +L F    PWI  ++ KL         +++K      + + +SD G     L +    +   ISEV   DG+L++GS   P+
Sbjct:  171 GLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKL-----FSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPF 407          
BLAST of CB290290 vs. ExPASy Swiss-Prot
Match: APMAP_SALSA (Adipocyte plasma membrane-associated protein OS=Salmo salar GN=apmap PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 8.209e-33
Identity = 86/242 (35.54%), Postives = 128/242 (52.89%), Query Frame = -1
Query:   17 GLLKVGPEGGLATAVATQSEGIPFR---FCNSLDIDQSTGIIYFTDSSSQFQRRNHISVILSGDKTGRLMKYDPATKQVTVFLGNLSFPNGVALSEDGNYILLAETTSCRILRYWLK-TSKAGTIEIVAQLPGFPDNIKRSPRGGFWVGIHSRRKGIFKLVLSF----PWIGNVLIKLPIDIVKIHSSLVKLSGNGGMAMRISDQGNVLEILEEIGRKMWRSISEVEGKDGNLWIGSVNMPY 718
            GL KV P  G  T + +  + +  R   F N LD+ Q    +YFTDSSS++QRR+++ +I+     GR+++YD  TK+VTV + NL F NG+ L  D   +L+AETT  RI R  +   +K G    V  LPGFPDNI+RS  GG+WV + + R      +L F    PWI  ++ KL    V     L+K      + + + + G  +    +    +   +SE    DG+L++GS   PY
Sbjct:  171 GLFKVNPVTGEVTNLVSAGQMVGGRRLSFVNDLDVTQDGRKVYFTDSSSRWQRRDYLHLIMEATADGRVLEYDTETKEVTVLMENLRFANGIQLFPDEESVLVAETTMARIRRVHVSGLNKGGMDTFVDNLPGFPDNIRRSSSGGYWVAMSAVRPNPGFSMLDFLSQKPWIKKLIFKLFSQDV-----LMKFVPRYSLVIELQESGACMRSFHDPHGMVAAYVSEAHEHDGHLYLGSFRSPY 407          
BLAST of CB290290 vs. ExPASy Swiss-Prot
Match: STSY_RAUSE (Strictosidine synthase OS=Rauvolfia serpentina GN=STR1 PE=1 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.119e-32
Identity = 71/178 (39.89%), Postives = 109/178 (61.24%), Query Frame = -1
Query:  203 FGLLKVGPEGGLATAVATQSEGIPFRFCNSLDIDQSTGIIYFTDSSSQFQRRNHISVILSGDKTGRLMKYDPATKQVTVFLGNLSFPNGVALSEDGNYILLAETTSCRILRYWLKTSKAGTIEIVAQLPGFPDNIKRSPRGGFWVGIHSRRKG-----IFKLVLSFPWIGNVLIKLPI 721
            + L  VG EGG AT +AT  +G+PF++  ++ +DQ TGI+YFTD S+ +  R    ++ + DKTGRL+KYDP+TK+ T+ L  L  P G  +S D +++L+AE  S +I++YWL+  K GT E++ ++P  P NIKR+  G FWV       G     +    + F   GN+L  +P+
Sbjct:  123 YHLSVVGSEGGHATQLATSVDGVPFKWLYAVTVDQRTGIVYFTDVSTLYDDRGVQQIMDTSDKTGRLIKYDPSTKETTLLLKELHVPGGAEVSADSSFVLVAEFLSHQIVKYWLEGPKKGTAEVLVKIPN-PGNIKRNADGHFWVSSSEELDGNMHGRVDPKGIKFDEFGNILEVIPL 299          
BLAST of CB290290 vs. ExPASy Swiss-Prot
Match: STSY_RAUMA (Strictosidine synthase (Fragment) OS=Rauvolfia mannii GN=STR1 PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 3.119e-32
Identity = 71/178 (39.89%), Postives = 109/178 (61.24%), Query Frame = -1
Query:  203 FGLLKVGPEGGLATAVATQSEGIPFRFCNSLDIDQSTGIIYFTDSSSQFQRRNHISVILSGDKTGRLMKYDPATKQVTVFLGNLSFPNGVALSEDGNYILLAETTSCRILRYWLKTSKAGTIEIVAQLPGFPDNIKRSPRGGFWVGIHSRRKG-----IFKLVLSFPWIGNVLIKLPI 721
            + L  VG EGG AT +AT  +G+PF++  ++ +DQ TGI+YFTD S+ +  R    ++ + DKTGRL+KYDP+TK+ T+ L  L  P G  +S D +++L+AE  S +I++YWL+  K GT E++ ++P  P NIKR+  G FWV       G     +    + F   GN+L  +P+
Sbjct:  121 YHLSVVGSEGGHATQLATSVDGVPFKWLYAVTVDQRTGIVYFTDVSTLYDDRGVQQIMDTSDKTGRLIKYDPSTKETTLLLKELHVPGGAEVSADSSFVLVAEFLSHQIVKYWLEGPKKGTAEVLVKIPN-PGNIKRNADGHFWVSSSEELDGNMHGRVDPKGIKFDEFGNILEVIPL 297          
BLAST of CB290290 vs. ExPASy Swiss-Prot
Match: STS1_ARATH (Strictosidine synthase 1 OS=Arabidopsis thaliana GN=SS1 PE=2 SV=2)

HSP 1 Score: 137.887 bits (346), Expect = 5.321e-32
Identity = 86/237 (36.29%), Postives = 127/237 (53.59%), Query Frame = -1
Query:   11 GLLKVGPEGGLATAVATQSEGIPFRFCNSLDIDQSTGIIYFTDSSSQFQRRNHISVILSGDKTGRLMKYDPATKQVTVFLGNLSFPNGVALSEDGNYILLAETTSCRILRYWLKTSKAGTIEIVAQLPGFPDNIKR-SPRGGFWVGIHSRRKGIFKLVLSFPWIGNVLIKLPIDIVKIHSSLVKLSGNGGMAMRISDQGNVLEILEEIGRKMWRSISEVEGKDGNLWIGSVNMPYAG 718
            GL  + P GGLAT +    +G PF+F + LD+D +TG++YFT  SS+F     +  +   D TG+L KYDP+TK VTV +  LS   G A+S DG+++L+++ T   I RYW+K  KAG+ E        PDNIKR    G FWV                    +V+ K+   IV  + S VK++ NG +   I        + ++ G  +   +SEV   +GNL+IG++  P+AG
Sbjct:  119 GLHVISPAGGLATKITDSVDGKPFKFLDGLDVDPTTGVVYFTSFSSRFSPIQVLIALGLKDATGKLYKYDPSTKVVTVLMEGLSGSAGCAVSSDGSFVLVSQFTKSNIKRYWIKGPKAGSSEDFTNSVSNPDNIKRIGSTGNFWV-------------------ASVVNKI---IVPTNPSAVKVNSNGEVLQTI-------PLKDKFGDTL---LSEVNEFEGNLYIGTLTGPFAG 323          
BLAST of CB290290 vs. ExPASy Swiss-Prot
Match: APMAP_BOVIN (Adipocyte plasma membrane-associated protein OS=Bos taurus GN=APMAP PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.449e-31
Identity = 84/242 (34.71%), Postives = 128/242 (52.89%), Query Frame = -1
Query:   17 GLLKVGP---EGGLATAVATQSEGIPFRFCNSLDIDQSTGIIYFTDSSSQFQRRNHISVILSGDKTGRLMKYDPATKQVTVFLGNLSFPNGVALSEDGNYILLAETTSCRILRYWLK-TSKAGTIEIVAQLPGFPDNIKRSPRGGFWVGIHSRRKGIFKLVLSF----PWIGNVLIKLPIDIVKIHSSLVKLSGNGGMAMRISDQGNVLEILEEIGRKMWRSISEVEGKDGNLWIGSVNMPY 718
            GL +V P   E  L  +  T  EG    F N L + +    IYFTDSSS++QRR+++ +++ G   GRL++YD  TK+V V L +L FPNGV LS   +++L+ E    RI R+++    K G    V  LPGFPDNI+ S  GG+WV + + R      +L F    P++  V+ KL         +++K      + + +SD G  L  L +   ++   +SE     G+L++GS   PY
Sbjct:  170 GLFEVNPWKREVKLLLSSETPIEGRKMSFLNDLTVTRDGRKIYFTDSSSKWQRRDYLLLLMEGTDDGRLLEYDTQTKEVKVLLDHLRFPNGVQLSPAEDFVLVVELAMVRIRRFYVSGLMKGGADVFVENLPGFPDNIRASSSGGYWVSMAAIRANPGFSMLDFLSERPFLKKVIFKL-----FSQETVMKFVPRYSLVLELSDSGTFLRSLHDPEGQVVTYVSEAHEHSGHLYLGSFRAPY 406          
BLAST of CB290290 vs. ExPASy Swiss-Prot
Match: APMAP_RAT (Adipocyte plasma membrane-associated protein OS=Rattus norvegicus GN=Apmap PE=2 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 4.504e-31
Identity = 84/242 (34.71%), Postives = 127/242 (52.48%), Query Frame = -1
Query:   17 GLLKVGPEGG---LATAVATQSEGIPFRFCNSLDIDQSTGIIYFTDSSSQFQRRNHISVILSGDKTGRLMKYDPATKQVTVFLGNLSFPNGVALSEDGNYILLAETTSCRILRYWLK-TSKAGTIEIVAQLPGFPDNIKRSPRGGFWVGIHSRRKGIFKLVLSF----PWIGNVLIKLPIDIVKIHSSLVKLSGNGGMAMRISDQGNVLEILEEIGRKMWRSISEVEGKDGNLWIGSVNMPY 718
            GL +V P+     L  +  T  EG    F N L I +    IYFTDSSS++QRR+++ +++ G   GRL++YD  TK+V V L  L FPNGV LS + +++L+AET   RI R ++    K G    V  +PGFPDNI+ S  GG+WV   + R      +L F    P+I  ++ KL         +++K      + + +SD G     L +   ++   +SE    DG L++GS   P+
Sbjct:  131 GLFEVNPQKRSVKLLLSSETPIEGKKMSFVNDLTITRDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTKEVKVLLDQLQFPNGVQLSPEEDFVLVAETAMARIRRVYVSGLMKGGADMFVENMPGFPDNIRPSSSGGYWVAAATIRANPGFSMLDFLSDKPFIKRMIFKL-----FSQETVMKFVPRYSLVLEVSDSGAFRRSLHDPDGQVVTYVSEAHEHDGYLYLGSFRSPF 367          
BLAST of CB290290 vs. ExPASy Swiss-Prot
Match: STSY_CATRO (Strictosidine synthase OS=Catharanthus roseus GN=STR1 PE=1 SV=2)

HSP 1 Score: 134.42 bits (337), Expect = 5.883e-31
Identity = 71/180 (39.44%), Postives = 106/180 (58.89%), Query Frame = -1
Query:  203 FGLLKVGPEGGLATAVATQSEGIPFRFCNSLDIDQSTGIIYFTDSSS--QFQRRNHISVILSGDKTGRLMKYDPATKQVTVFLGNLSFPNGVALSEDGNYILLAETTSCRILRYWLKTSKAGTIEIVAQLPGFPDNIKRSPRGGFWVGIHSRRKG-----IFKLVLSFPWIGNVLIKLPI 721
            + L  VG EGG AT +AT  +G+PF++  ++ +DQ TGI+YFTD SS           ++ + D+TGRLMKYDP+TK+ T+ L  L  P G  +S DG+++++AE  S RI++YWL+  K G+ E +  +P  P NIKR+  G FWV       G     +    + F   GN+L  +P+
Sbjct:  127 YHLCVVGKEGGYATQLATSVQGVPFKWLYAVTVDQRTGIVYFTDVSSIHDDSPEGVEEIMNTSDRTGRLMKYDPSTKETTLLLKELHVPGGAEISADGSFVVVAEFLSNRIVKYWLEGPKKGSAEFLVTIPN-PGNIKRNSDGHFWVSSSEELDGGQHGRVVSRGIKFDGFGNILQVIPL 305          
BLAST of CB290290 vs. ExPASy Swiss-Prot
Match: APMAP_MOUSE (Adipocyte plasma membrane-associated protein OS=Mus musculus GN=Apmap PE=1 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.311e-30
Identity = 82/242 (33.88%), Postives = 127/242 (52.48%), Query Frame = -1
Query:   17 GLLKVGPEGG---LATAVATQSEGIPFRFCNSLDIDQSTGIIYFTDSSSQFQRRNHISVILSGDKTGRLMKYDPATKQVTVFLGNLSFPNGVALSEDGNYILLAETTSCRILRYWLK-TSKAGTIEIVAQLPGFPDNIKRSPRGGFWVGIHSRRKGIFKLVLSF----PWIGNVLIKLPIDIVKIHSSLVKLSGNGGMAMRISDQGNVLEILEEIGRKMWRSISEVEGKDGNLWIGSVNMPY 718
            GL +V P+     L  +  T  EG    F N L + +    IYFTDSSS++QRR+++ +++     GRL++YD  TK+V V L  L FPNGV LS + +++L+AETT  RI R ++    K G    V  +PGFPDNI+ S  GG+WV   + R      +L F    P+I  ++ K+         +++K      + + +SD G     L +   ++   +SE    DG L++GS   P+
Sbjct:  170 GLFEVNPQKRSVKLLLSSETPIEGKKMSFVNDLTVTRDGRKIYFTDSSSKWQRRDYLLLVMEATDDGRLLEYDTVTKEVKVLLDQLQFPNGVQLSPEEDFVLVAETTMARIRRVYVSGLMKGGADMFVENMPGFPDNIRPSSSGGYWVAAATIRANPGFSMLDFLSDKPFIKRMIFKM-----FSQETVMKFVPRYSLVLEVSDSGAFRRSLHDPDGQVVTYVSEAHEHDGYLYLGSFRSPF 406          
BLAST of CB290290 vs. ExPASy Swiss-Prot
Match: APMAP_DANRE (Adipocyte plasma membrane-associated protein OS=Danio rerio GN=apmap PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.712e-30
Identity = 84/247 (34.01%), Postives = 126/247 (51.01%), Query Frame = -1
Query:   17 GLLKVGPEGGLATAVATQSEGIPFR---FCNSLDIDQSTGIIYFTDSSSQFQRRNHISVILSGDKTGRLMKYDPATKQVTVFLGNLSFPNGVALSEDGNYILLAETTSCRILRYWLK-TSKAGTIEIVAQLPGFPDNIKRSPRGGFWVGIHSRRKGIFKLVLSF----PWIGNVLIKL-----PIDIVKIHSSLVKLSGNGGMAMRISDQGNVLEILEEIGRKMWRSISEVEGKDGNLWIGSVNMPY 718
            GL +V P  G   ++ +  + I  R   F N LD+ Q    +YFTDSSS++QRR+ + +I+     GR+++YD  TK+V V + NL FPNG+ L  D   +L+AETT  RI R  +   +K G    +  LPGFPDNI+RS  GG+WV + + R      +L F    PW+  ++ KL      +  V  +S +V+L  +G       D   ++              SE     G+L++GS   PY
Sbjct:  170 GLFEVNPVTGEVKSLVSTEKRIAGRRLGFVNDLDVTQDGKKVYFTDSSSRWQRRDFMHLIMEATADGRVLEYDTETKEVNVMMENLRFPNGIQLFPDEESVLVAETTMARIKRVHVSGLNKGGMDTFIENLPGFPDNIRRSSSGGYWVAMSAVRPNPGFSMLDFLSQRPWLKKLIFKLFSQDTLLKFVPRYSLVVELQSDGTCVRSFHDPQGLVSAYS----------SEAHEYSGHLYLGSFRSPY 406          
The following BLAST results are available for this feature:
BLAST of CB290290 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
APMAP_HUMAN9.697e-3436.78Adipocyte plasma membrane-associated protein OS=Ho... [more]
APMAP_SALSA8.209e-3335.54Adipocyte plasma membrane-associated protein OS=Sa... [more]
STSY_RAUSE3.119e-3239.89Strictosidine synthase OS=Rauvolfia serpentina GN=... [more]
STSY_RAUMA3.119e-3239.89Strictosidine synthase (Fragment) OS=Rauvolfia man... [more]
STS1_ARATH5.321e-3236.29Strictosidine synthase 1 OS=Arabidopsis thaliana G... [more]
APMAP_BOVIN3.449e-3134.71Adipocyte plasma membrane-associated protein OS=Bo... [more]
APMAP_RAT4.504e-3134.71Adipocyte plasma membrane-associated protein OS=Ra... [more]
STSY_CATRO5.883e-3139.44Strictosidine synthase OS=Catharanthus roseus GN=S... [more]
APMAP_MOUSE1.311e-3033.88Adipocyte plasma membrane-associated protein OS=Mu... [more]
APMAP_DANRE1.712e-3034.01Adipocyte plasma membrane-associated protein OS=Da... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_01af01_b1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01af01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB290290 ID=CB290290|Name=CB290290|organism=Citrus sinensis|type=EST|length=721bp
AATTGTAATAACCTGCATAAGGCATATTAACTGAACCAATCCACAAATTC
CCATCTTTCCCTTCAACTTCACTAATAGATCTCCACATCTTTCTACCTAT
TTCTTCCAAAATCTCCAATACATTCCCTTGGTCACTTATCCTCATAGCCA
TTCCACCATTCCCACTTAGCTTAACCAAACTTGAATGAATTTTAACAATG
TCAATTGGTAGTTTAATCAAAACATTTCCTATCCAAGGAAATGAAAGAAC
CAATTTAAAGATCCCTTTCCTTCTCGAATGGATACCAACCCAAAATCCTC
CTCTGGGGCTTCTTTTTATGTTATCTGGAAACCCTGGGAGTTGAGCGACG
ATTTCTATTGTTCCGGCTTTCGATGTTTTTAGCCAATACCTTAGAATTCT
GCAGCTTGTTGTCTCTGCAAGTAATATGTAATTGCCATCTTCACTCAAAG
CCACCCCATTTGGAAATGAGAGATTCCCAAGAAAAACAGTTACTTGTTTT
GTTGCTGGGTCATACTTCATTAGCCTTCCTGTTTTATCACCACTTAGTAT
TACAGAAATGTGGTTCCTCCTTTGAAACTGTGAACTGCTGTCGGTAAAAT
AAATGATTCCGGTGGATTGATCGATGTCTAGACTATTACAGAATCTGAAA
GGAATGCCCTCTGATTGAGTAGCAACGGCAGTGGCCAATCCTCCTTCGGG
TCCCACTTTAAGCAATCCAAA
back to top