CB290296

Overview
NameCB290296
Unique NameCB290296
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length751
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7791 contig Csv1_Contig7791:28..778. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB290296 vs. ExPASy Swiss-Prot
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 212.231 bits (539), Expect = 2.396e-54
Identity = 104/112 (92.86%), Postives = 107/112 (95.54%), Query Frame = -1
Query:  416 REAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFFELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPPKPMVVETFFDYPPFGCFAVRDMRQTVAVGVIKNVEKKDP 751
            +EAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF ELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIP KPMVVETF +YPP G FAVRDMRQTVAVGVIKNVEKKDP
Sbjct:  323 KEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 434          
BLAST of CB290296 vs. ExPASy Swiss-Prot
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 5.338e-54
Identity = 102/112 (91.07%), Postives = 107/112 (95.54%), Query Frame = -1
Query:  416 REAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFFELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPPKPMVVETFFDYPPFGCFAVRDMRQTVAVGVIKNVEKKDP 751
            +EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKMIP KPMVVETF +YPP G FAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  323 KEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of CB290296 vs. ExPASy Swiss-Prot
Match: EF1A_PEA (Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.189e-53
Identity = 101/112 (90.18%), Postives = 107/112 (95.54%), Query Frame = -1
Query:  416 REAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFFELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPPKPMVVETFFDYPPFGCFAVRDMRQTVAVGVIKNVEKKDP 751
            ++AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKMIP KPMVVETF +YPP G FAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  323 KDAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of CB290296 vs. ExPASy Swiss-Prot
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 2.028e-53
Identity = 102/112 (91.07%), Postives = 106/112 (94.64%), Query Frame = -1
Query:  416 REAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFFELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPPKPMVVETFFDYPPFGCFAVRDMRQTVAVGVIKNVEKKDP 751
            +EAA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF ELVTKIDRRSGKELEKEPKFLKNGDAGMVKM+P KPMVVETF  YPP G FAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  323 KEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of CB290296 vs. ExPASy Swiss-Prot
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 208.379 bits (529), Expect = 3.460e-53
Identity = 101/112 (90.18%), Postives = 106/112 (94.64%), Query Frame = -1
Query:  416 REAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFFELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPPKPMVVETFFDYPPFGCFAVRDMRQTVAVGVIKNVEKKDP 751
            +EAANFT+QVII+NHPGQIGNGYAPVLDCHTSHIAVKF EL+TKIDRRSGKELEKEPKFLKNGDAG VKMIP KPMVVETF +YPP G FAVRDMRQTVAVGVIKNVEKKDP
Sbjct:  323 KEAANFTAQVIIINHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDP 434          
BLAST of CB290296 vs. ExPASy Swiss-Prot
Match: EF1A_MANES (Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 1.007e-52
Identity = 101/112 (90.18%), Postives = 105/112 (93.75%), Query Frame = -1
Query:  416 REAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFFELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPPKPMVVETFFDYPPFGCFAVRDMRQTVAVGVIKNVEKKDP 751
            +EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSGKELEKEPKFLKNGDAG VKMIP KPMVVETF  YPP G FAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  323 KEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of CB290296 vs. ExPASy Swiss-Prot
Match: EF1A2_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 1.717e-52
Identity = 100/112 (89.29%), Postives = 104/112 (92.86%), Query Frame = -1
Query:  416 REAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFFELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPPKPMVVETFFDYPPFGCFAVRDMRQTVAVGVIKNVEKKDP 751
            +EAANFT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+ TKIDRRSGKELEKEPKFLKNGDAG VKMIP KPMVVETF  YPP G FAVRDMRQTVAVGVIK+VEKKDP
Sbjct:  323 KEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIQTKIDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETFMSYPPLGRFAVRDMRQTVAVGVIKSVEKKDP 434          
BLAST of CB290296 vs. ExPASy Swiss-Prot
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 2.243e-52
Identity = 99/110 (90.00%), Postives = 105/110 (95.45%), Query Frame = -1
Query:  416 AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFFELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPPKPMVVETFFDYPPFGCFAVRDMRQTVAVGVIKNVEKKDP 745
            AA+FTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSGKE+EKEPKFLKNGDAGMVKMIP KPMVVETF +YPP G FAVRDMRQTVAVGVIKNV+KKDP
Sbjct:  325 AASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDP 434          
BLAST of CB290296 vs. ExPASy Swiss-Prot
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 3.826e-52
Identity = 98/110 (89.09%), Postives = 105/110 (95.45%), Query Frame = -1
Query:  416 AANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFFELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPPKPMVVETFFDYPPFGCFAVRDMRQTVAVGVIKNVEKKDP 745
            AA+FT+QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E++TKIDRRSGKELEKEPKFLKNGDAGMVKMIP KPMVVETF +YPP G FAVRDMRQTVAVGV+KNV+KKDP
Sbjct:  325 AASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDP 434          
BLAST of CB290296 vs. ExPASy Swiss-Prot
Match: EF1A_WHEAT (Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 8.522e-52
Identity = 101/112 (90.18%), Postives = 103/112 (91.96%), Query Frame = -1
Query:  416 REAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFFELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPPKPMVVETFFDYPPFGCFAVRDMRQTVAVGVIKNVEKKDP 751
            +EAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF ELVTKIDRRSGKELE  PKFLKNGDAG+VKMIP KPMVVETF  YPP G FAVRDMRQTVAVGVIK VEKKDP
Sbjct:  323 KEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEALPKFLKNGDAGIVKMIPTKPMVVETFATYPPLGRFAVRDMRQTVAVGVIKGVEKKDP 434          
The following BLAST results are available for this feature:
BLAST of CB290296 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 163
Match NameE-valueIdentityDescription
EF1A_ORYSJ2.396e-5492.86Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_VICFA5.338e-5491.07Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]
EF1A_PEA1.189e-5390.18Elongation factor 1-alpha OS=Pisum sativum PE=2 SV... [more]
EF1A_MAIZE2.028e-5391.07Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A_SOYBN3.460e-5390.18Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A_MANES1.007e-5290.18Elongation factor 1-alpha OS=Manihot esculenta GN=... [more]
EF1A2_DAUCA1.717e-5289.29Elongation factor 1-alpha OS=Daucus carota PE=2 SV... [more]
EF1A_TOBAC2.243e-5290.00Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A_SOLLC3.826e-5289.09Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A_WHEAT8.522e-5290.18Elongation factor 1-alpha OS=Triticum aestivum GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_01af04_b1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01af04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB290296 ID=CB290296|Name=CB290296|organism=Citrus sinensis|type=EST|length=751bp
TTTTTTTTTTTTTTTTTACCAAAAAATGTTTTACCCTGTTGTCTCATTTC
TCTCATATGATCGACAAAGTTAAAAACATCAAATGGAACCATCAAAAACA
GTCCCCCTTTCTCTCAGGGCAAAATTTAATACAACACCTACAAAATATAT
GAGCCCCGACTAAATTTTCAAAATCGAGCACTAACGGCTAATCTTGAAAC
AAAATGTTTGACATCCAAAAACTGGTTTATCAACTTACCAAAAAAAAACT
CTGATATAAAACCAAATTCAAAAAATTAAAATGAAGTCCCGTAAAACAAA
CTAAAACACAACAAAAATAGCATAAACAAAAAAAATAAAAGCTAACTATA
GCAAATAAATCCCAAAAAACTCCTCACTTCTTCTTGGCTGCAAACTTGGT
GACCTTGGCACCTGTTGGATCCTTCTTTTCAACATTCTTAATCACACCAA
CAGCAACAGTCTGACGCATGTCCCTAACGGCAAAACAACCAAAAGGGGGG
TAGTCAAAAAAGGTTTCAACAACCATGGGCTTGGGGGGAATCATCTTAAC
CATTCCAGCATCTCCATTCTTCAAAAACTTGGGCTCCTTCTCAAGCTCCT
TGCCTGATCGCCTATCAATCTTCGTCACAAGCTCAAAAAACTTGACGGCA
ATGTGGGAGGTGTGGCAGTCAAGCACTGGGGCATATCCATTTCCAATCTG
GCCAGGGTGGTTCATGATGATGACCTGTGAGGTGAAGTTGGCAGCTTCCC
T
back to top