CB293609
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CB293609 vs. ExPASy Swiss-Prot
Match: QKIL1_ARATH (KH domain-containing protein At4g26475 OS=Arabidopsis thaliana GN=At4g26475 PE=2 SV=1) HSP 1 Score: 122.479 bits (306), Expect = 2.944e-27 Identity = 61/70 (87.14%), Postives = 68/70 (97.14%), Query Frame = -2 Query: 619 EIVDARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMKRAKTRG 828 EIVDARLMQAREIL+DLL PV+E+HDFYKKQQLRELA+LNG+LREEGSPMSGS+SP+ NSLGMKRAKTRG Sbjct: 240 EIVDARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSISPY-NSLGMKRAKTRG 308
BLAST of CB293609 vs. ExPASy Swiss-Prot
Match: QKIL2_ARATH (KH domain-containing protein At5g56140 OS=Arabidopsis thaliana GN=At5g56140 PE=2 SV=1) HSP 1 Score: 118.627 bits (296), Expect = 4.250e-26 Identity = 60/69 (86.96%), Postives = 66/69 (95.65%), Query Frame = -2 Query: 622 EIVDARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMKRAKTR 828 EIVDARLMQAREIL+DLL P++E+HD YKKQQLRELA+LNGTLREEGSPMSGSVSP+ NSLGMKRAKTR Sbjct: 246 EIVDARLMQAREILDDLLTPMEETHDMYKKQQLRELALLNGTLREEGSPMSGSVSPY-NSLGMKRAKTR 313
BLAST of CB293609 vs. ExPASy Swiss-Prot
Match: QKIL4_ARATH (KH domain-containing protein At3g08620 OS=Arabidopsis thaliana GN=At3g08620 PE=2 SV=1) HSP 1 Score: 83.9593 bits (206), Expect = 1.160e-15 Identity = 44/68 (64.71%), Postives = 53/68 (77.94%), Query Frame = -2 Query: 625 EIVDARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLNGTLREEGSPMSGSVSPFHNSLGMKRAKT 828 +IVD +L QA+EI+E+L+KPVDES D+ K+QQLRELA+LN LRE SGSVSPF NS MKR KT Sbjct: 215 DIVDIKLRQAQEIIEELVKPVDESQDYIKRQQLRELALLNSNLRENSPGPSGSVSPF-NSNAMKRPKT 281
BLAST of CB293609 vs. ExPASy Swiss-Prot
Match: QKIL3_ARATH (KH domain-containing protein At2g38610 OS=Arabidopsis thaliana GN=At2g38610 PE=1 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 9.193e-13 Identity = 45/70 (64.29%), Postives = 53/70 (75.71%), Query Frame = -2 Query: 625 IVDARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLN-GTLREE--GSPMSGSVSPFHNSLGMKRAKT 825 IV+ RL QA+EI+E+LLKPVDES DF K+QQLRELA+LN LREE G GSVSPF++S KR KT Sbjct: 217 IVEIRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNNLREESPGPSGGGSVSPFNSS--GKRPKT 284
BLAST of CB293609 vs. ExPASy Swiss-Prot
Match: QKIL5_ARATH (KH domain-containing protein At1g09660 OS=Arabidopsis thaliana GN=At1g09660 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 3.862e-11 Identity = 39/70 (55.71%), Postives = 50/70 (71.43%), Query Frame = -2 Query: 625 EIVDARLMQAREILEDLLKPVDESHDFYKKQQLRELAMLNGTLREEG-SP-MSGSVSPFHNSLGMKRAKT 828 +I+++RL A LE LLKP+DES D YK++QL+ELA LNGTLREE SP +S +SP + KRAKT Sbjct: 227 DIINSRLEHAVHFLESLLKPMDESMDHYKREQLKELAALNGTLREESPSPSLSPCLSPSMSPFNSKRAKT 296 The following BLAST results are available for this feature:
BLAST of CB293609 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CB293609 ID=CB293609; Name=CB293609; organism=Citrus sinensis; type=EST; length=829bpback to top |