CB294009

Overview
NameCB294009
Unique NameCB294009
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length633
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB294009_ssr97 microsatellite CB294009_ssr97:97..116. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig10238 contig Csv1_Contig10238:38..670. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB294009 vs. ExPASy Swiss-Prot
Match: KSG7_ARATH (Shaggy-related protein kinase eta OS=Arabidopsis thaliana GN=ASK7 PE=1 SV=2)

HSP 1 Score: 297.745 bits (761), Expect = 3.151e-80
Identity = 146/156 (93.59%), Postives = 150/156 (96.15%), Query Frame = 2
Query:  161 MADDKEMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTRKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIH 628
            MADDKEM AAVVDG D VTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNV+ LKHCFFSTT K+ELFLNLVMEYVPES+YRVLKHYSSANQRMPL+YVKLY YQIFRGLAYIH
Sbjct:    1 MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVPESLYRVLKHYSSANQRMPLVYVKLYMYQIFRGLAYIH 156          
BLAST of CB294009 vs. ExPASy Swiss-Prot
Match: KSG6_ARATH (Shaggy-related protein kinase zeta OS=Arabidopsis thaliana GN=ASK6 PE=1 SV=2)

HSP 1 Score: 289.271 bits (739), Expect = 1.121e-77
Identity = 138/155 (89.03%), Postives = 152/155 (98.06%), Query Frame = 2
Query:  167 DDKEMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTRKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIHT 631
            +DKEMSAAV++G+D VTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGE+VAIKKVLQDRRYKNRELQLMR+MDHPNV+SLKHCFFSTT ++ELFLNLVMEYVPE++YRVLKHY+S+NQRMP+ YVKLYTYQIFRGLAYIHT
Sbjct:   35 NDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFSTTTRDELFLNLVMEYVPETLYRVLKHYTSSNQRMPIFYVKLYTYQIFRGLAYIHT 189          
BLAST of CB294009 vs. ExPASy Swiss-Prot
Match: KSG9_ARATH (Shaggy-related protein kinase iota OS=Arabidopsis thaliana GN=ASK9 PE=2 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 5.562e-77
Identity = 138/154 (89.61%), Postives = 150/154 (97.40%), Query Frame = 2
Query:  170 DKEMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTRKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIHT 631
            DKEMSAAV++G+D VTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGE+VAIKKVLQDRRYKNRELQLMR MDHPNVISLKHCFFSTT ++ELFLNLVMEYVPE++YRVL+HY+S+NQRMP+ YVKLYTYQIFRGLAYIHT
Sbjct:   34 DKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGESVAIKKVLQDRRYKNRELQLMRPMDHPNVISLKHCFFSTTSRDELFLNLVMEYVPETLYRVLRHYTSSNQRMPIFYVKLYTYQIFRGLAYIHT 187          
BLAST of CB294009 vs. ExPASy Swiss-Prot
Match: KSG5_ARATH (Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 1.568e-71
Identity = 129/154 (83.77%), Postives = 142/154 (92.21%), Query Frame = 2
Query:  167 DDKEMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTRKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIH 628
            DDKEM AAVVDG+   TGHII TTIGGKNG+PKQTISYMAER+VG GSFGIVFQAKCLETGETVAIKKVLQD+RYKNRELQ MR++DHPNV+SLKHCFFSTT K+EL+LNLV+EYVPE++YRV KHYS ANQRMP+IYVKLYTYQI R LAYIH
Sbjct:   37 DDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVYRVSKHYSRANQRMPIIYVKLYTYQICRALAYIH 190          
BLAST of CB294009 vs. ExPASy Swiss-Prot
Match: KSG1_ARATH (Shaggy-related protein kinase alpha OS=Arabidopsis thaliana GN=ASK1 PE=2 SV=3)

HSP 1 Score: 266.544 bits (680), Expect = 7.780e-71
Identity = 126/154 (81.82%), Postives = 142/154 (92.21%), Query Frame = 2
Query:  167 DDKEMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTRKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIH 628
            DDKEM A VVDG+   TGHII TTIGG+NG+PKQTISYMAERVVG GSFG+VFQAKCLETGETVAIKKVLQDRRYKNRELQ MR++DHPNV+SLKHCFFSTT K+EL+LNLV+EYVPE+++RV+KHY+  NQRMPLIYVKLYTYQIFR L+YIH
Sbjct:   32 DDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLIYVKLYTYQIFRALSYIH 185          
BLAST of CB294009 vs. ExPASy Swiss-Prot
Match: MSK1_MEDSA (Glycogen synthase kinase-3 homolog MsK-1 OS=Medicago sativa GN=MSK-1 PE=2 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 2.956e-70
Identity = 124/154 (80.52%), Postives = 142/154 (92.21%), Query Frame = 2
Query:  167 DDKEMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTRKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIH 628
            DD+EM A VVDG+   TGHII TTIGG+NG+PKQTISYMAERVVG GSFG+VFQAKCLETGETVAIKKVLQD+RYKNRELQ MR++DHPNV+SLKHCFFSTT K+EL+LNLV+EYVPE+++RV+KHYS  NQRMP+IYVKLYTYQIFR L+YIH
Sbjct:   38 DDREMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYSKLNQRMPMIYVKLYTYQIFRALSYIH 191          
BLAST of CB294009 vs. ExPASy Swiss-Prot
Match: KSG3_ARATH (Shaggy-related protein kinase gamma OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 8.601e-70
Identity = 123/154 (79.87%), Postives = 142/154 (92.21%), Query Frame = 2
Query:  167 DDKEMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTRKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIH 628
            DDKEM A +V+G+   TGHII TTIGG+NG+PKQTISYMAERVVG GSFG+VFQAKCLETGETVAIKKVLQDRRYKNRELQ MR++DHPNV+SLKHCFFSTT K+EL+LNLV+EYVPE+++RV+KHY+  NQRMPL+YVKLYTYQIFR L+YIH
Sbjct:   36 DDKEMEATIVNGNVTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVHRVIKHYNKLNQRMPLVYVKLYTYQIFRSLSYIH 189          
BLAST of CB294009 vs. ExPASy Swiss-Prot
Match: MSK1_TOBAC (Shaggy-related protein kinase NtK-1 OS=Nicotiana tabacum GN=NTK-1 PE=2 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 6.164e-68
Identity = 119/154 (77.27%), Postives = 141/154 (91.56%), Query Frame = 2
Query:  167 DDKEMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTRKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIH 628
            DDKE+ AA+VDG+   TGHII TTIGG++G+PKQTISYMAER+VG GSFG+VFQAKCLETGETVAIKKVLQD+RYKNRELQ MR++DHPNV+ LKHCFFSTT K+E++LNLV+EYVPE+++RV+KHY+  NQRMPLI VKLYTYQIFR L+YIH
Sbjct:   36 DDKEIEAAIVDGNGTETGHIIVTTIGGRHGQPKQTISYMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVCLKHCFFSTTEKDEVYLNLVLEYVPETVHRVIKHYNKLNQRMPLILVKLYTYQIFRALSYIH 189          
BLAST of CB294009 vs. ExPASy Swiss-Prot
Match: MSK2_MEDSA (Glycogen synthase kinase-3 homolog MsK-2 OS=Medicago sativa GN=MSK-2 PE=2 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 8.051e-68
Identity = 120/154 (77.92%), Postives = 139/154 (90.26%), Query Frame = 2
Query:  167 DDKEMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTRKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIH 628
            DDKEM A VVDG+    GH+I TTIGGKNG+PKQTISYMAER VG GSFG+VFQAKCLETGETVAIKKVLQD+RYKNRELQ MR++DHPNV++LKHCFFSTT K+EL+LNLV+E+VPE+++RV++HYS  NQRMPLIYVKLY+YQI R LAYIH
Sbjct:   37 DDKEMEAHVVDGNSTEAGHVIVTTIGGKNGQPKQTISYMAERAVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVTLKHCFFSTTEKDELYLNLVLEFVPETVHRVIRHYSKMNQRMPLIYVKLYSYQICRSLAYIH 190          
BLAST of CB294009 vs. ExPASy Swiss-Prot
Match: MSK3_MEDSA (Glycogen synthase kinase-3 homolog MsK-3 OS=Medicago sativa GN=MSK-3 PE=2 SV=2)

HSP 1 Score: 256.144 bits (653), Expect = 1.051e-67
Identity = 123/155 (79.35%), Postives = 141/155 (90.97%), Query Frame = 2
Query:  167 DDKEMSAA-VVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFSTTRKNELFLNLVMEYVPESMYRVLKHYSSANQRMPLIYVKLYTYQIFRGLAYIH 628
            DDKEM AA +VDG+   TGHII TTIGGKNG+PKQTISYMAERVVG GSFG+VFQAKCLETGETVAIKKVLQD+RYKNRELQ MR++DHPNV+SLKHCFFSTT K+EL+LNLV+EYVPE++ RV++HY+  NQRMP+IYVKLY+YQI R LAYIH
Sbjct:   36 DDKEMEAATIVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPETVSRVIRHYNKMNQRMPMIYVKLYSYQICRALAYIH 190          
The following BLAST results are available for this feature:
BLAST of CB294009 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
KSG7_ARATH3.151e-8093.59Shaggy-related protein kinase eta OS=Arabidopsis t... [more]
KSG6_ARATH1.121e-7789.03Shaggy-related protein kinase zeta OS=Arabidopsis ... [more]
KSG9_ARATH5.562e-7789.61Shaggy-related protein kinase iota OS=Arabidopsis ... [more]
KSG5_ARATH1.568e-7183.77Shaggy-related protein kinase epsilon OS=Arabidops... [more]
KSG1_ARATH7.780e-7181.82Shaggy-related protein kinase alpha OS=Arabidopsis... [more]
MSK1_MEDSA2.956e-7080.52Glycogen synthase kinase-3 homolog MsK-1 OS=Medica... [more]
KSG3_ARATH8.601e-7079.87Shaggy-related protein kinase gamma OS=Arabidopsis... [more]
MSK1_TOBAC6.164e-6877.27Shaggy-related protein kinase NtK-1 OS=Nicotiana t... [more]
MSK2_MEDSA8.051e-6877.92Glycogen synthase kinase-3 homolog MsK-2 OS=Medica... [more]
MSK3_MEDSA1.051e-6779.35Glycogen synthase kinase-3 homolog MsK-3 OS=Medica... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_06bc02_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_06bc02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB294009 ID=CB294009|Name=CB294009|organism=Citrus sinensis|type=EST|length=633bp
GCTTGGGTCCTCCTTTCTCTCATTCTCCATCGCCACACCATGATCATCAT
CTTCTCCCTCATCCACCGGTGAAATTTCTCCATTTCTCTTCCATCGCTCT
CTCTCTCTCTCTCTCTCCCTCCCTCTCTTTCTTCACCCCAATTTCTCTCC
AAATCTCCCCATGGCCGACGATAAGGAGATGTCTGCTGCTGTTGTTGATG
GGAGTGACCATGTCACTGGTCACATCATTTCCACCACCATTGGAGGCAAA
AATGGAGAGCCAAAACAGACTATTAGCTACATGGCGGAGCGTGTTGTGGG
AACTGGGTCATTTGGTATTGTCTTCCAGGCTAAATGCTTGGAAACTGGAG
AGACTGTGGCTATCAAGAAGGTTTTGCAGGACAGAAGATATAAGAATCGT
GAACTGCAGTTAATGCGGGTGATGGATCATCCAAATGTGATTTCTTTGAA
GCATTGTTTCTTTTCAACTACCAGAAAAAACGAACTTTTCCTCAACTTGG
TTATGGAATACGTACCAGAGAGCATGTATAGGGTTTTGAAGCATTACAGC
AGTGCAAATCAGAGAATGCCCCTCATATATGTGAAACTTTATACGTACCA
GATTTTCAGGGGCCTGGCTTACATCCACACTGT
back to top