CB294010

Overview
NameCB294010
Unique NameCB294010
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length352
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB294010_ssr25 microsatellite CB294010_ssr25:25..48. BLAST: Citrus ESTs to Prunus persica proteins V1
CB294010_ssr151 microsatellite CB294010_ssr151:151..168. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CB294010 vs. ExPASy Swiss-Prot
Match: GID2_ARATH (F-box protein GID2 OS=Arabidopsis thaliana GN=GID2 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.517e-14
Identity = 32/50 (64.00%), Postives = 44/50 (88.00%), Query Frame = 1
Query:  202 GFTNPDDNLLLEVMKHADARNLARAACLNELWHKTAQDERLRELICTRHF 351
            GF+N D+NL+ EV+KH DA+ LA ++C++++WHKTAQDERL ELICTRH+
Sbjct:   31 GFSNLDENLVYEVLKHVDAKTLAMSSCVSKIWHKTAQDERLWELICTRHW 80          
The following BLAST results are available for this feature:
BLAST of CB294010 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
GID2_ARATH2.517e-1464.00F-box protein GID2 OS=Arabidopsis thaliana GN=GID2... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_06bd06_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_06bd06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB294010 ID=CB294010|Name=CB294010|organism=Citrus sinensis|type=EST|length=352bp
GCCCTTTGCAACACTTTCCATTTCCTCTCTCTCTCTCTCTCTCTCTCTCA
CTCTCTCCCTCTGCCTCTCCAATTTTACTTTATGAAGCGGATGGGACTTG
ATTCCCCGGTCACCGCCGAAGACAAGCAAAAGATGAAGAAAGTCAAACAA
GAGGAGGAGGAGGAGGAGGACGACGAAGAGGGAGAGCAATCCAAAGAAAC
TGGCTTCACGAATCCGGACGACAACCTTCTGCTCGAGGTGATGAAACACG
CGGACGCCAGGAATTTGGCGCGGGCGGCCTGCCTAAACGAGCTCTGGCAC
AAGACCGCTCAAGACGAGCGCCTCAGGGAGTTGATCTGCACCCGCCACTT
CG
back to top