CB294011

Overview
NameCB294011
Unique NameCB294011
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length719
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB294011_ssr40 microsatellite CB294011_ssr40:40..51. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1814 contig Csv1_Contig1814:32..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB294011 vs. ExPASy Swiss-Prot
Match: UMPK_ARATH (Uridylate kinase OS=Arabidopsis thaliana GN=PYR6 PE=1 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.324e-83
Identity = 149/176 (84.66%), Postives = 166/176 (94.32%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEESGNDKFLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCSEEEMERRILNRNQGREDDNVETIMKRLKVFLQSSLPVVQYYEAKGKVQKIDAAKPVAEVFDAVKAVFTP 719
            LGGPGSGKGTQCA IVEH+GYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKA++E+GNDKFLIDGFPRNEENRAAFE VT+IEP+FVLFFDC EEEME+R+L RNQGREDDN+ETI KR KVFL+SSLPV+ YYEAKGKV+KI+AAKP+  VF+ VKA+F+P
Sbjct:   20 LGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAIQENGNDKFLIDGFPRNEENRAAFEKVTEIEPKFVLFFDCPEEEMEKRLLGRNQGREDDNIETIRKRFKVFLESSLPVIHYYEAKGKVRKINAAKPIEAVFEEVKAIFSP 195          
BLAST of CB294011 vs. ExPASy Swiss-Prot
Match: KAD_PRUAR (Adenylate kinase OS=Prunus armeniaca PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 4.582e-60
Identity = 110/176 (62.50%), Postives = 139/176 (78.98%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEESGNDKFLIDGFPRNEENRAAFEAVTKIEPEFVLFFDCSEEEMERRILNRNQGREDDNVETIMKRLKVFLQSSLPVVQYYEAKGKVQKIDAAKPVAEVFDAVKAVFTP 719
            LGGPGSGKGTQCA IVE FG+TH+SAGDLLR EI SGS  G++I + I+EGKIVPS+VT++L+QK ME S N KFLIDGFPR+EENR AFE     EP+ VLFFDC E+EM +R+LNRNQGR DDN++TI KRL++F + + PV+ YY  +GK+ KI+A   V E+F+ V+ +F P
Sbjct:   53 LGGPGSGKGTQCAKIVEAFGFTHVSAGDLLRREIASGSAYGSVILSTIREGKIVPSQVTVELIQKEMESSDNYKFLIDGFPRSEENRKAFEQTIGAEPDVVLFFDCPEQEMVKRVLNRNQGRVDDNIDTIKKRLEIFDELNWPVINYYSQRGKLHKINAVGTVDEIFEKVRPIFAP 228          
BLAST of CB294011 vs. ExPASy Swiss-Prot
Match: KCY_CHICK (UMP-CMP kinase OS=Gallus gallus GN=CMPK1 PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.918e-46
Identity = 99/184 (53.80%), Postives = 128/184 (69.57%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIK-SGSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEE-----SGNDKFLIDGFPRNEENRAAFEAVT--KIEPEFVLFFDCSEEEMERRILNR--NQGREDDNVETIMKRLKVFLQSSLPVVQYYEAKGKVQKIDAAKPVAEVFDAVKAVF 713
            LGGPG+GKGTQCA IVE +GYTHLSAGDLLR E K  GS+ G +I+N IKEG+IVP E+TI LL++AM++     S  +KFLIDGFPRNE+N   +      K +  FVLFFDC  E    R L R  + GR DDN E++ KR+  +LQS+ P++  YE  GKV+++DA+K V EVF+ V  +F
Sbjct:    9 LGGPGAGKGTQCARIVEKYGYTHLSAGDLLRDERKRPGSQYGELIENYIKEGEIVPVEITISLLKRAMDQTMAANSQKNKFLIDGFPRNEDNLQGWNKTMDGKADVSFVLFFDCDNEICIGRCLERGKSSGRSDDNRESLEKRIHTYLQSTRPIIDLYERMGKVRRVDASKSVDEVFEKVVQIF 192          
BLAST of CB294011 vs. ExPASy Swiss-Prot
Match: KCY_XENLA (UMP-CMP kinase OS=Xenopus laevis GN=cmpk1 PE=2 SV=2)

HSP 1 Score: 184.111 bits (466), Expect = 6.423e-46
Identity = 97/184 (52.72%), Postives = 128/184 (69.57%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKS-GSENGTMIQNMIKEGKIVPSEVTIKLLQKAME-----ESGNDKFLIDGFPRNEENRAAFEAVT--KIEPEFVLFFDCSEEEMERRILNRNQ--GREDDNVETIMKRLKVFLQSSLPVVQYYEAKGKVQKIDAAKPVAEVFDAVKAVF 713
            LGGPG+GKGTQC  IV+ +GYTHLSAGDLLR E K   S+ G +I++ I++GKIVP E+TI LLQ+AME     ++   KFLIDGFPRNE+N   +E     K +  FVLFFDC  E    R L R +  GR DDN E++ KR++ +LQS+ P++  YE +GKV+K+DA+K V EVF  V+ +F
Sbjct:    9 LGGPGAGKGTQCERIVQKYGYTHLSAGDLLRDERKKPDSQYGELIESYIRDGKIVPVEITISLLQRAMERTMAFDANKHKFLIDGFPRNEDNLQGWERTMNGKADVSFVLFFDCDNETCIERCLERGKSSGRSDDNRESLEKRIQTYLQSTRPIIDLYEKRGKVRKVDASKSVDEVFTKVQNIF 192          
BLAST of CB294011 vs. ExPASy Swiss-Prot
Match: KCY_XENTR (UMP-CMP kinase OS=Xenopus tropicalis GN=cmpk1 PE=2 SV=2)

HSP 1 Score: 182.185 bits (461), Expect = 2.441e-45
Identity = 98/184 (53.26%), Postives = 129/184 (70.11%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKS-GSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEES----GND-KFLIDGFPRNEENRAAFEAVT--KIEPEFVLFFDCSEEEMERRILNRNQ--GREDDNVETIMKRLKVFLQSSLPVVQYYEAKGKVQKIDAAKPVAEVFDAVKAVF 713
            LGGPG+GKGTQC  IV+ +GYTHLSAGDLLR E K   S+ G +I++ I++G+IVP E+TI LLQ+AME++    GN  KFLIDGFPRNE+N   +E     K +  FVLFFDC  E    R L R +  GR DDN E++ KR++ +LQS+ P++  YE  GKV+K+DA+K V EVF  V+ +F
Sbjct:    9 LGGPGAGKGTQCERIVQKYGYTHLSAGDLLRDERKKPDSQYGELIESYIRDGRIVPVEITISLLQRAMEQTMALDGNKHKFLIDGFPRNEDNLQGWERTMNGKADVSFVLFFDCDNETCIERCLERGKSSGRSDDNRESLEKRIQTYLQSTRPIIDLYEKTGKVKKVDASKSVDEVFTKVQDIF 192          
BLAST of CB294011 vs. ExPASy Swiss-Prot
Match: KCY_HUMAN (UMP-CMP kinase OS=Homo sapiens GN=CMPK1 PE=1 SV=3)

HSP 1 Score: 181.03 bits (458), Expect = 5.437e-45
Identity = 97/184 (52.72%), Postives = 128/184 (69.57%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKS-GSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEES-----GNDKFLIDGFPRNEENRAAFEAVT--KIEPEFVLFFDCSEEEMERRILNRNQ--GREDDNVETIMKRLKVFLQSSLPVVQYYEAKGKVQKIDAAKPVAEVFDAVKAVF 713
            LGGPG+GKGTQCA IVE +GYTHLSAG+LLR E K+  S+ G +I+  IKEGKIVP E+TI LL++ M+++       +KFLIDGFPRN++N   +      K +  FVLFFDC+ E    R L R +  GR DDN E++ KR++ +LQS+ P++  YE  GKV+KIDA+K V EVFD V  +F
Sbjct:    9 LGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIF 192          
BLAST of CB294011 vs. ExPASy Swiss-Prot
Match: KCY_DICDI (Cytidylate kinase OS=Dictyostelium discoideum GN=pyrK PE=1 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 5.437e-45
Identity = 95/178 (53.37%), Postives = 125/178 (70.22%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEESGNDKFLIDGFPRNEENRAAFEAVTK--IEPEFVLFFDCSEEEMERRILNRNQ--GREDDNVETIMKRLKVFLQSSLPVVQYYEAKGKVQKIDAAKPVAEVFDAVKAVF 713
            LGGPGSGKGTQCANIV  FG+ HLSAGDLLR E +SGS++G MI  MIK G+IVPS VT+KLL+ A++ +    FL+DGFPRNEEN  ++E   K  ++ +FVLFFDC EE M +R+L R +  GR DDN+E+I KR   F   +  V+ +Y    KV+ I A + V EV++ V+ +F
Sbjct:   13 LGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLF 190          
BLAST of CB294011 vs. ExPASy Swiss-Prot
Match: KCY_DANRE (UMP-CMP kinase OS=Danio rerio GN=cmpk1 PE=2 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 5.437e-45
Identity = 99/183 (54.10%), Postives = 131/183 (71.58%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAE-IKSGSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEESGND-----KFLIDGFPRNEENRAAF--EAVTKIEPEFVLFFDCSEEEMERRILNRNQ--GREDDNVETIMKRLKVFLQSSLPVVQYYEAKGKVQKIDAAKPVAEVFDAVKAV 710
            LGGPG+GKGTQCA IVE++ YTHLSAGDLLR E  ++ SE G +I + IKEGKIVP ++TI LL+KAMEE+        +FLIDGFPRN++N   +  E   K + +FVLFFDCS E    R L R +  GR DDN E++ KR++ +LQS+ P+++ YE +GKVQ+IDA++ V EVF  VK +
Sbjct:    9 LGGPGAGKGTQCARIVENYSYTHLSAGDLLREERSRTDSEFGQLIDSYIKEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDASRSVDEVFADVKNI 191          
BLAST of CB294011 vs. ExPASy Swiss-Prot
Match: KCY_PIG (UMP-CMP kinase OS=Sus scrofa GN=CMPK1 PE=1 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.211e-44
Identity = 96/184 (52.17%), Postives = 128/184 (69.57%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKS-GSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEES-----GNDKFLIDGFPRNEENRAAFEAVT--KIEPEFVLFFDCSEEEMERRILNRNQ--GREDDNVETIMKRLKVFLQSSLPVVQYYEAKGKVQKIDAAKPVAEVFDAVKAVF 713
            LGGPG+GKGTQCA IVE +GYTHLSAG+LLR E K+  S+ G +I+  IK+GKIVP E+TI LL++ M+++       +KFLIDGFPRN++N   +      K +  FVLFFDC+ E    R L R +  GR DDN E++ KR++ +LQS+ P++  YE  GKV+KIDA+K V EVFD V  +F
Sbjct:    9 LGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKDGKIVPVEITISLLRREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVKIF 192          
BLAST of CB294011 vs. ExPASy Swiss-Prot
Match: KCY_BOVIN (UMP-CMP kinase OS=Bos taurus GN=CMPK1 PE=2 SV=2)

HSP 1 Score: 179.874 bits (455), Expect = 1.211e-44
Identity = 96/184 (52.17%), Postives = 128/184 (69.57%), Query Frame = 3
Query:  192 LGGPGSGKGTQCANIVEHFGYTHLSAGDLLRAEIKS-GSENGTMIQNMIKEGKIVPSEVTIKLLQKAMEES-----GNDKFLIDGFPRNEENRAAFEAVT--KIEPEFVLFFDCSEEEMERRILNRNQ--GREDDNVETIMKRLKVFLQSSLPVVQYYEAKGKVQKIDAAKPVAEVFDAVKAVF 713
            LGGPG+GKGTQCA IVE +GYTHLSAG+LLR E K+  S+ G +I+  IK+GKIVP E+TI LL++ M+++       +KFLIDGFPRN++N   +      K +  FVLFFDC+ E    R L R +  GR DDN E++ KR++ +LQS+ P++  YE  GKV+KIDA+K V EVFD V  +F
Sbjct:    9 LGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKDGKIVPVEITISLLRREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVRKIDASKSVDEVFDEVVKIF 192          
The following BLAST results are available for this feature:
BLAST of CB294011 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
UMPK_ARATH1.324e-8384.66Uridylate kinase OS=Arabidopsis thaliana GN=PYR6 P... [more]
KAD_PRUAR4.582e-6062.50Adenylate kinase OS=Prunus armeniaca PE=2 SV=1[more]
KCY_CHICK4.918e-4653.80UMP-CMP kinase OS=Gallus gallus GN=CMPK1 PE=2 SV=1[more]
KCY_XENLA6.423e-4652.72UMP-CMP kinase OS=Xenopus laevis GN=cmpk1 PE=2 SV=... [more]
KCY_XENTR2.441e-4553.26UMP-CMP kinase OS=Xenopus tropicalis GN=cmpk1 PE=2... [more]
KCY_HUMAN5.437e-4552.72UMP-CMP kinase OS=Homo sapiens GN=CMPK1 PE=1 SV=3[more]
KCY_DICDI5.437e-4553.37Cytidylate kinase OS=Dictyostelium discoideum GN=p... [more]
KCY_DANRE5.437e-4554.10UMP-CMP kinase OS=Danio rerio GN=cmpk1 PE=2 SV=2[more]
KCY_PIG1.211e-4452.17UMP-CMP kinase OS=Sus scrofa GN=CMPK1 PE=1 SV=1[more]
KCY_BOVIN1.211e-4452.17UMP-CMP kinase OS=Bos taurus GN=CMPK1 PE=2 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_06bf01_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_06bf01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB294011 ID=CB294011|Name=CB294011|organism=Citrus sinensis|type=EST|length=719bp
TTGGCATCCCTCTGCCTTCTTTCTTTCCCTCCATATTCTTCTCTCTCTCT
CCAAACAAAACAACGCTCGCAATTCGCTAAGATCGGTTATTCAGACTGAG
TTAGTTGGCGCTGATGGGAACTGTGGTTGAAACTCCTGTCAAGGAAGCAG
ATGCTACCGTAACTGTGAAGAAGCCCACTGTTGTTTTTGTTTTGGGTGGA
CCAGGCAGTGGAAAAGGAACCCAGTGCGCAAACATTGTTGAACACTTTGG
ATACACCCATCTCAGTGCTGGTGATCTTCTCAGAGCCGAAATCAAATCTG
GCTCTGAAAATGGAACCATGATTCAGAACATGATTAAAGAGGGAAAAATC
GTTCCTTCAGAGGTCACAATTAAGCTTCTCCAAAAAGCAATGGAGGAAAG
TGGAAATGATAAATTTCTCATCGATGGTTTTCCCAGAAACGAGGAAAATC
GTGCTGCATTTGAAGCTGTTACCAAAATTGAGCCAGAATTCGTTCTGTTT
TTTGACTGTTCTGAGGAGGAGATGGAGAGGCGCATTTTGAATAGGAATCA
GGGAAGAGAAGATGATAACGTTGAGACAATTATGAAGCGGCTTAAGGTTT
TCTTACAATCTAGTCTCCCTGTGGTTCAATATTATGAAGCTAAGGGTAAA
GTTCAGAAGATTGATGCTGCAAAGCCTGTTGCAGAGGTTTTTGATGCTGT
TAAAGCTGTTTTTACCCCA
back to top