CB294018

Overview
NameCB294018
Unique NameCB294018
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length663
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB294018_ssr24 microsatellite CB294018_ssr24:24..39. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig8865 contig Csv1_Contig8865:7..668. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB294018 vs. ExPASy Swiss-Prot
Match: CYC3_ARATH (Probable cytochrome c At4g10040 OS=Arabidopsis thaliana GN=At4g10040 PE=2 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.497e-59
Identity = 107/112 (95.54%), Postives = 110/112 (98.21%), Query Frame = 2
Query:   83 MASFDEAPPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 418
            MASFDEAPPGN KAGEKIF+TKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANK+MAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK+ TA
Sbjct:    1 MASFDEAPPGNPKAGEKIFRTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKSMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEGTA 112          
BLAST of CB294018 vs. ExPASy Swiss-Prot
Match: CYC_ABUTH (Cytochrome c OS=Abutilon theophrasti PE=1 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 9.700e-59
Identity = 105/111 (94.59%), Postives = 108/111 (97.30%), Query Frame = 2
Query:   86 ASFDEAPPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 418
            ASF +APPG+AKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNW E TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK+STA
Sbjct:    1 ASFQZAPPGBAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWGENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKZSTA 111          
BLAST of CB294018 vs. ExPASy Swiss-Prot
Match: CYC_CUCMA (Cytochrome c OS=Cucurbita maxima PE=1 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 3.686e-58
Identity = 105/111 (94.59%), Postives = 109/111 (98.20%), Query Frame = 2
Query:   86 ASFDEAPPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 418
            ASFDEAPPGN+KAGEKIFKTKCAQCHTV+KGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKN AV WEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK++TA
Sbjct:    1 ASFDEAPPGNSKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNRAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEATA 111          
BLAST of CB294018 vs. ExPASy Swiss-Prot
Match: CYC_SAMNI (Cytochrome c OS=Sambucus nigra PE=1 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 8.212e-58
Identity = 106/111 (95.50%), Postives = 107/111 (96.40%), Query Frame = 2
Query:   86 ASFDEAPPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 418
            ASF EAPPGN KAGEKIFKTKC QCHTV+KGAGHKQGPNLNGLFGRQSGTT GYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA
Sbjct:    1 ASFAEAPPGNPKAGEKIFKTKCNQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 111          
BLAST of CB294018 vs. ExPASy Swiss-Prot
Match: CYC_BRAOL (Cytochrome c OS=Brassica oleracea PE=1 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.401e-57
Identity = 104/111 (93.69%), Postives = 108/111 (97.30%), Query Frame = 2
Query:   86 ASFDEAPPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 418
            ASFDEAPPGN+KAGEKIFKTKCAQCHTV+KGAGHKQGPNLNGLFGRQSGTT GYSYSAANKN AV WEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK++TA
Sbjct:    1 ASFDEAPPGNSKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVEWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEATA 111          
BLAST of CB294018 vs. ExPASy Swiss-Prot
Match: CYC_BRANA (Cytochrome c OS=Brassica napus PE=1 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.401e-57
Identity = 104/111 (93.69%), Postives = 108/111 (97.30%), Query Frame = 2
Query:   86 ASFDEAPPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 418
            ASFDEAPPGN+KAGEKIFKTKCAQCHTV+KGAGHKQGPNLNGLFGRQSGTT GYSYSAANKN AV WEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK++TA
Sbjct:    1 ASFDEAPPGNSKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVEWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEATA 111          
BLAST of CB294018 vs. ExPASy Swiss-Prot
Match: CYC2_ARATH (Probable cytochrome c At1g22840 OS=Arabidopsis thaliana GN=At1g22840 PE=1 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.401e-57
Identity = 105/112 (93.75%), Postives = 107/112 (95.54%), Query Frame = 2
Query:   83 MASFDEAPPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 418
            MASFDEAPPGNAKAGEKIF+TKCAQCHTVE GAGHKQGPNLNGLFGRQSGTT GYSYSAANKN AV WEEK LYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK+STA
Sbjct:    1 MASFDEAPPGNAKAGEKIFRTKCAQCHTVEAGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVEWEEKALYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA 112          
BLAST of CB294018 vs. ExPASy Swiss-Prot
Match: CYC_PHAAU (Cytochrome c OS=Phaseolus aureus PE=1 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.829e-57
Identity = 104/111 (93.69%), Postives = 108/111 (97.30%), Query Frame = 2
Query:   86 ASFDEAPPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 418
            ASFDEAPPGN+K+GEKIFKTKCAQCHTV+KGAGHKQGPNLNGLFGRQSGTT GYSYS ANKNMAV WEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK+STA
Sbjct:    1 ASFDEAPPGNSKSGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSTANKNMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA 111          
BLAST of CB294018 vs. ExPASy Swiss-Prot
Match: CYC_RICCO (Cytochrome c OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 9.079e-57
Identity = 101/111 (90.99%), Postives = 106/111 (95.50%), Query Frame = 2
Query:   86 ASFDEAPPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 418
            ASF++APPG+ KAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTT GYSYSAANKNMAV W E TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK++TA
Sbjct:    1 ASFBZAPPGBVKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVQWGENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKZATA 111          
BLAST of CB294018 vs. ExPASy Swiss-Prot
Match: CYC_GOSBA (Cytochrome c OS=Gossypium barbadense PE=1 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 9.079e-57
Identity = 102/111 (91.89%), Postives = 106/111 (95.50%), Query Frame = 2
Query:   86 ASFDEAPPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQSTA 418
            ASF +APPG+AKAGEKIFKTKCAQCHTV+KGAGHKQGPNLNGLFGRQSGTT GYSYSAANKNMAV W E TLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK+STA
Sbjct:    1 ASFQZAPPGBAKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNMAVQWGENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKZSTA 111          
The following BLAST results are available for this feature:
BLAST of CB294018 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 174
Match NameE-valueIdentityDescription
CYC3_ARATH1.497e-5995.54Probable cytochrome c At4g10040 OS=Arabidopsis tha... [more]
CYC_ABUTH9.700e-5994.59Cytochrome c OS=Abutilon theophrasti PE=1 SV=1[more]
CYC_CUCMA3.686e-5894.59Cytochrome c OS=Cucurbita maxima PE=1 SV=1[more]
CYC_SAMNI8.212e-5895.50Cytochrome c OS=Sambucus nigra PE=1 SV=1[more]
CYC_BRAOL1.401e-5793.69Cytochrome c OS=Brassica oleracea PE=1 SV=1[more]
CYC_BRANA1.401e-5793.69Cytochrome c OS=Brassica napus PE=1 SV=1[more]
CYC2_ARATH1.401e-5793.75Probable cytochrome c At1g22840 OS=Arabidopsis tha... [more]
CYC_PHAAU1.829e-5793.69Cytochrome c OS=Phaseolus aureus PE=1 SV=1[more]
CYC_RICCO9.079e-5790.99Cytochrome c OS=Ricinus communis PE=1 SV=1[more]
CYC_GOSBA9.079e-5791.89Cytochrome c OS=Gossypium barbadense PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_06dd03_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_06dd03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB294018 ID=CB294018|Name=CB294018|organism=Citrus sinensis|type=EST|length=663bp
GCACTAGGAGAACGCAATCACAGCTCTCTCTCTCTCTCTGCGCTCTTCTT
TCTCTCTTTGGATATTTCAAAACACCACAATAATGGCGTCGTTTGATGAG
GCACCTCCCGGCAATGCAAAGGCCGGAGAGAAGATCTTCAAGACCAAGTG
CGCTCAGTGCCACACCGTCGAGAAAGGCGCCGGTCACAAACAAGGTCCTA
ATTTGAACGGATTGTTTGGAAGGCAATCGGGGACTACACCTGGGTACTCA
TACTCTGCGGCTAACAAGAACATGGCTGTGAATTGGGAGGAAAAGACTTT
GTATGATTACTTGCTCAACCCTAAGAAGTACATTCCTGGAACAAAGATGG
TATTCCCTGGATTGAAGAAGCCTCAGGATCGTGCTGACCTTATTGCATAT
TTGAAACAATCTACTGCATAAGAACTTGCCGATAGTCAGTTTACCTATTC
CATTTTGCAGTTGTTGAAGATTGTTTTGCGGTGCGGATATAGTACTGTTT
TTTACCAATAAATTTTAAACATTTAAGGTTCAGCAATGTTCTTTGTAACT
TGAGCATTGCTAATTTGAGAAAAGGTTGCTGTCATTGGCAAACATGATAT
TCAATTGAATTTCCTGGTTATAATCATATTTCATGAATTTTGGGTGAACC
CAAAAAAAACAAA
back to top