CB294021

Overview
NameCB294021
Unique NameCB294021
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length324
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB294021 vs. ExPASy Swiss-Prot
Match: C76C4_ARATH (Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 8.078e-29
Identity = 62/106 (58.49%), Postives = 75/106 (70.75%), Query Frame = -2
Query:    6 EWAMTELLRNPDILSKVRLELEQPIGKCNPIGESDISRLPYLQAVFKETFRLHPAVPLLLPGKAPADSEGAGFKGPNGAQVLVNPWGIGRDGELRDNPYSFIPERF 323
            EWAM ELLRNP  + K + E+++ +G+ + + ESDIS LPYLQAV KETFRLHPA PLL+P KA +D E  GF  P   QVLVN W IGRD  + +NP  F PERF
Sbjct:  321 EWAMAELLRNPKTMVKAQAEMDRVLGQNSVVQESDISGLPYLQAVVKETFRLHPAAPLLVPRKAESDVEVLGFMVPKDTQVLVNVWAIGRDPSVWENPSQFEPERF 426          
BLAST of CB294021 vs. ExPASy Swiss-Prot
Match: C76A1_SOLME (Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 4.009e-28
Identity = 60/106 (56.60%), Postives = 73/106 (68.87%), Query Frame = -2
Query:    6 EWAMTELLRNPDILSKVRLELEQPIGKCNPIGESDISRLPYLQAVFKETFRLHPAVPLLLPGKAPADSEGAGFKGPNGAQVLVNPWGIGRDGELRDNPYSFIPERF 323
            EWA+TELLR+P  ++KV+LE+ Q IG      E DI  LPY+QAV KE  RLHP +PLL+P KA  D++  G+  P G QVLVN W IGRD E  DNP+ F PERF
Sbjct:  281 EWALTELLRHPQAMAKVKLEILQVIGPNKKFEECDIDSLPYMQAVLKEQLRLHPPLPLLIPRKAIQDTKFMGYDIPKGTQVLVNAWAIGRDPEYWDNPFEFKPERF 386          
BLAST of CB294021 vs. ExPASy Swiss-Prot
Match: C76C1_ARATH (Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 5.236e-28
Identity = 62/106 (58.49%), Postives = 75/106 (70.75%), Query Frame = -2
Query:    6 EWAMTELLRNPDILSKVRLELEQPIGKCNPIGESDISRLPYLQAVFKETFRLHPAVPLLLPGKAPADSEGAGFKGPNGAQVLVNPWGIGRDGELRDNPYSFIPERF 323
            EWAMTELL+NP  ++K + E++  IG+   + ESDIS+LPYLQAV KETFRLH  VPLL+P KA +D+E  GF      QVLVN W IGRD  + DNP  F PERF
Sbjct:  321 EWAMTELLKNPKTMAKAQAEIDCVIGQNGIVEESDISKLPYLQAVVKETFRLHTPVPLLIPRKAESDAEILGFMVLKDTQVLVNVWAIGRDPSVWDNPSQFEPERF 426          
BLAST of CB294021 vs. ExPASy Swiss-Prot
Match: C76C2_ARATH (Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.990e-27
Identity = 61/106 (57.55%), Postives = 72/106 (67.92%), Query Frame = -2
Query:    6 EWAMTELLRNPDILSKVRLELEQPIGKCNPIGESDISRLPYLQAVFKETFRLHPAVPLLLPGKAPADSEGAGFKGPNGAQVLVNPWGIGRDGELRDNPYSFIPERF 323
            EWAM ELLRNP+ + K + E++  IG+   + ESDIS LPYLQAV KETFRLHPA PLL+P KA +D E  GF  P   QV VN W IGRD  + +N   F PERF
Sbjct:  322 EWAMAELLRNPETMVKAQAEIDCVIGQKGVVEESDISALPYLQAVVKETFRLHPAAPLLVPRKAESDVEVLGFMVPKDTQVFVNVWAIGRDPNVWENSSRFKPERF 427          
BLAST of CB294021 vs. ExPASy Swiss-Prot
Match: C76A2_SOLME (Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 3.176e-25
Identity = 54/106 (50.94%), Postives = 71/106 (66.98%), Query Frame = -2
Query:    6 EWAMTELLRNPDILSKVRLELEQPIGKCNPIGESDISRLPYLQAVFKETFRLHPAVPLLLPGKAPADSEGAGFKGPNGAQVLVNPWGIGRDGELRDNPYSFIPERF 323
            EWA+TELLR+P+ ++KV+ E+ Q I       +SDI  LPY+QAV KE+ RLHP +P L+P +   D++  G+  P   QVLVN W IGRD E  D+P SF PERF
Sbjct:  319 EWALTELLRHPEAMAKVKTEISQAIEPNRKFEDSDIENLPYMQAVLKESLRLHPPLPFLIPRETIQDTKFMGYDVPKDTQVLVNAWAIGRDPECWDDPMSFKPERF 424          
BLAST of CB294021 vs. ExPASy Swiss-Prot
Match: C76B1_HELTU (7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 5.991e-24
Identity = 55/106 (51.89%), Postives = 67/106 (63.21%), Query Frame = -2
Query:    6 EWAMTELLRNPDILSKVRLELEQPIGKCNPIGESDISRLPYLQAVFKETFRLHPAVPLLLPGKAPADSEGAGFKGPNGAQVLVNPWGIGRDGELRDNPYSFIPERF 323
            EWAMTELLR P I+SK + ELE+ IGK + + E D+ RLPYL  + KE  RLHP  PLLLP K     E +G+  P G  V VN W IGRD  + D+   F P+RF
Sbjct:  303 EWAMTELLRKPHIMSKAKEELEKVIGKGSIVKEDDVLRLPYLSCIVKEVLRLHPPSPLLLPRKVVTQVELSGYTIPAGTLVFVNAWAIGRDPTVWDDSLEFKPQRF 408          
BLAST of CB294021 vs. ExPASy Swiss-Prot
Match: C76C3_ARATH (Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 1.022e-23
Identity = 55/106 (51.89%), Postives = 70/106 (66.04%), Query Frame = -2
Query:    6 EWAMTELLRNPDILSKVRLELEQPIGKCNPIGESDISRLPYLQAVFKETFRLHPAVPLLLPGKAPADSEGAGFKGPNGAQVLVNPWGIGRDGELRDNPYSFIPERF 323
            EWAMTEL R+ + + K + E+ Q IG+   + ESDI  LPYLQA+ KET RLHPA P L+P K+ +D +  GF  P   QV+VN W IGRD  + +NP  F PERF
Sbjct:  323 EWAMTELFRSTEKMVKAQSEIRQVIGQNGFVQESDIPSLPYLQAIVKETLRLHPAAP-LIPRKSESDVQIMGFLVPKNTQVVVNVWAIGRDASVWENPMKFEPERF 427          
BLAST of CB294021 vs. ExPASy Swiss-Prot
Match: F3PH_ARATH (Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.335e-23
Identity = 52/106 (49.06%), Postives = 70/106 (66.04%), Query Frame = -2
Query:    6 EWAMTELLRNPDILSKVRLELEQPIGKCNPIGESDISRLPYLQAVFKETFRLHPAVPLLLPGKAPADSEGAGFKGPNGAQVLVNPWGIGRDGELRDNPYSFIPERF 323
            +WA+ EL+R+PDI+ K + EL+  +G+  P+ ESDI++LPYLQAV KE FRLHP  PL LP  A    E  G+  P G+ +L N W I RD +   +P +F PERF
Sbjct:  312 DWAIAELIRHPDIMVKAQEELDIVVGRDRPVNESDIAQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLAFKPERF 417          
BLAST of CB294021 vs. ExPASy Swiss-Prot
Match: C98A3_ARATH (Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.335e-23
Identity = 50/106 (47.17%), Postives = 70/106 (66.04%), Query Frame = -2
Query:    6 EWAMTELLRNPDILSKVRLELEQPIGKCNPIGESDISRLPYLQAVFKETFRLHPAVPLLLPGKAPADSEGAGFKGPNGAQVLVNPWGIGRDGELRDNPYSFIPERF 323
            EWAM E+++NP +  KV+ E ++ +G    + E+D SRLPYLQ V KE+FRLHP  PL+LP ++ AD +  G+  P G+ V VN W + RD  +  NP+ F PERF
Sbjct:  309 EWAMAEMIKNPRVQQKVQEEFDRVVGLDRILTEADFSRLPYLQCVVKESFRLHPPTPLMLPHRSNADVKIGGYDIPKGSNVHVNVWAVARDPAVWKNPFEFRPERF 414          
BLAST of CB294021 vs. ExPASy Swiss-Prot
Match: C98A1_SORBI (Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.276e-23
Identity = 50/106 (47.17%), Postives = 70/106 (66.04%), Query Frame = -2
Query:    6 EWAMTELLRNPDILSKVRLELEQPIGKCNPIGESDISRLPYLQAVFKETFRLHPAVPLLLPGKAPADSEGAGFKGPNGAQVLVNPWGIGRDGELRDNPYSFIPERF 323
            EWAM EL+RNP +  K++ EL++ +G+   + E+D   LPYLQAV KE+ RLHP  PL+LP KA  + +  G+  P GA V+VN W + RD ++  NP  + PERF
Sbjct:  312 EWAMAELVRNPRVQKKLQEELDRVVGRDRVMLETDFQNLPYLQAVVKESLRLHPPTPLMLPHKASTNVKIGGYDIPKGANVMVNVWAVARDPKVWSNPLEYRPERF 417          
The following BLAST results are available for this feature:
BLAST of CB294021 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 188
Match NameE-valueIdentityDescription
C76C4_ARATH8.078e-2958.49Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CY... [more]
C76A1_SOLME4.009e-2856.60Cytochrome P450 76A1 (Fragment) OS=Solanum melonge... [more]
C76C1_ARATH5.236e-2858.49Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CY... [more]
C76C2_ARATH1.990e-2757.55Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CY... [more]
C76A2_SOLME3.176e-2550.94Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76... [more]
C76B1_HELTU5.991e-2451.897-ethoxycoumarin O-deethylase OS=Helianthus tubero... [more]
C76C3_ARATH1.022e-2351.89Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CY... [more]
F3PH_ARATH1.335e-2349.06Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana... [more]
C98A3_ARATH1.335e-2347.17Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CY... [more]
C98A1_SORBI2.276e-2347.17Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_01aa05_b1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01aa05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB294021 ID=CB294021|Name=CB294021|organism=Citrus sinensis|type=EST|length=324bp
CCCCAAAACCTCTCTGGAATAAAAGAGTATGGGTTGTCCCTTAATTCACC
ATCCCTTCCTATACCCCATGGGTTGACTAAAACTTGGGCCCCATTTGGCC
CCTTGAACCCGGCACCTTCTGAATCTGCTGGGGCTTTACCGGGAAGTAAA
AGAGGAACTGCCGGGTGCAACCGGAAGGTTTCTTTGAATACTGCTTGTAA
ATAAGGCAAGCGGCTGATGTCTGATTCCCCAATTGGATTGCATTTCCCAA
TCGGTTGTTCCAACTCTAATCGGACTTTTGATAAAATATCTGGGTTGCGA
AGTAGTTCTGTCATTGCCCATTCC
back to top