CB294024

Overview
NameCB294024
Unique NameCB294024
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length821
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1684 contig Csv1_Contig1684:818..1638. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB294024 vs. ExPASy Swiss-Prot
Match: TCMO_POPKI (Trans-cinnamate 4-monooxygenase OS=Populus kitakamiensis GN=CYP73A16 PE=2 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 9.678e-116
Identity = 206/248 (83.06%), Postives = 216/248 (87.10%), Query Frame = -2
Query:   77 VEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANNPAQWKKXXXXXXXXXXXXESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHWTIVAKPRSF 820
            V+ERKKLASTK+MSNE LKCAIDHILDAQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLR+ELDT+LGPGHQITEPDT+KLPYL AV+KETLRLRMAIPLLVPHMNLHDAKLGG+D+PAESKILVNAWWLANNPA WK              +KVEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQSKIDT+EKGGQFSLHILKH TIVAKPRSF
Sbjct:  258 VDERKKLASTKNMSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVVKETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERFLEEGAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVAKPRSF 505          
BLAST of CB294024 vs. ExPASy Swiss-Prot
Match: TCMO_POPTM (Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 3.678e-115
Identity = 206/248 (83.06%), Postives = 216/248 (87.10%), Query Frame = -2
Query:   77 VEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANNPAQWKKXXXXXXXXXXXXESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHWTIVAKPRSF 820
            V+ERKKLASTK+M NE LKCAIDHILDAQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLR+ELDT+LGPGHQITEPDT+KLPYL AV+KETLRLRMAIPLLVPHMNLHDAKLGG+D+PAESKILVNAWWLANNPA WK             E+KVEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQSKIDT+EKGGQFSLHILKH TIVAKPRSF
Sbjct:  258 VDERKKLASTKNMCNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRHELDTLLGPGHQITEPDTYKLPYLNAVVKETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPAHWKNPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVAKPRSF 505          
BLAST of CB294024 vs. ExPASy Swiss-Prot
Match: TCMO_GLYEC (Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 2.636e-113
Identity = 204/248 (82.26%), Postives = 212/248 (85.48%), Query Frame = -2
Query:   77 VEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANNPAQWKKXXXXXXXXXXXXESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHWTIVAKPRSF 820
            V+ER KL STKS SNE LKCAIDHILDAQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKK+R+E+D VLGPGHQ+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYD+PAESKILVNAWWLANNPA WK+            ES VEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQSK+DTAEKGGQFSLHILKH TIVAKPRSF
Sbjct:  258 VDERMKLESTKSTSNEGLKCAIDHILDAQKKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKVRDEIDRVLGPGHQVTEPDMQKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPANWKRPEEFRPERFLEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKLDTAEKGGQFSLHILKHSTIVAKPRSF 505          
BLAST of CB294024 vs. ExPASy Swiss-Prot
Match: TCMO_CICAR (Trans-cinnamate 4-monooxygenase OS=Cicer arietinum GN=CYP73A19 PE=2 SV=2)

HSP 1 Score: 400.208 bits (1027), Expect = 7.177e-111
Identity = 200/248 (80.65%), Postives = 209/248 (84.27%), Query Frame = -2
Query:   77 VEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANNPAQWKKXXXXXXXXXXXXESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHWTIVAKPRSF 820
            V+ERKKL STKS +NE LKCAIDHILDAQ KGEIN+DNVLYIVENINVAAIETTLWSIEWGIAELVNH +IQ K+R E+D VLGPGHQ+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKL G+D+PAESKILVNAWWLANNPAQWKK            ES VEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKH TIV KPRSF
Sbjct:  257 VDERKKLGSTKSTTNEGLKCAIDHILDAQQKGEINDDNVLYIVENINVAAIETTLWSIEWGIAELVNHQKIQNKVREEIDRVLGPGHQVTEPDLQKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLSGFDIPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHSTIVCKPRSF 504          
BLAST of CB294024 vs. ExPASy Swiss-Prot
Match: TCMO_CATRO (Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 7.177e-111
Identity = 201/248 (81.05%), Postives = 212/248 (85.48%), Query Frame = -2
Query:   77 VEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANNPAQWKKXXXXXXXXXXXXESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHWTIVAKPRSF 820
            V+ERKK  STKSM N SLKCAIDHIL+AQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLR+EL+TVLGPG QITEPDT+KLPYLQAVIKETLRLRMAIPL +PHMNLHDAKLGGYD+PAESKILVNAW+LANNP  WKK            ESKVEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPG+SKIDT+EKGGQFSLHILKH TIV KPR+F
Sbjct:  258 VDERKKFGSTKSMDNNSLKCAIDHILEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRDELETVLGPGVQITEPDTYKLPYLQAVIKETLRLRMAIPLFLPHMNLHDAKLGGYDIPAESKILVNAWFLANNPEHWKKPEEFRPERFLEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGKSKIDTSEKGGQFSLHILKHSTIVLKPRTF 505          
BLAST of CB294024 vs. ExPASy Swiss-Prot
Match: TCMO_PHAAU (Trans-cinnamate 4-monooxygenase OS=Phaseolus aureus GN=CYP73A2 PE=1 SV=1)

HSP 1 Score: 399.438 bits (1025), Expect = 1.224e-110
Identity = 197/248 (79.44%), Postives = 211/248 (85.08%), Query Frame = -2
Query:   77 VEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANNPAQWKKXXXXXXXXXXXXESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHWTIVAKPRSF 820
            V+ERK + STKS +NE LKCAIDHILDA+ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQ+K+R+E+D VLG GHQ+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNLHDAKLGGYD+PAESKILVNAWWLANNPA WKK            ES VEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQS+IDT+EKGGQFSLHILKH T+VAKPRSF
Sbjct:  258 VDERKNIGSTKSTNNEGLKCAIDHILDAEKKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQQKVRDEIDRVLGVGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFFEEESHVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTSEKGGQFSLHILKHSTVVAKPRSF 505          
BLAST of CB294024 vs. ExPASy Swiss-Prot
Match: TCMO_PEA (Trans-cinnamate 4-monooxygenase OS=Pisum sativum GN=CYP73A9 PE=2 SV=2)

HSP 1 Score: 399.438 bits (1025), Expect = 1.224e-110
Identity = 200/248 (80.65%), Postives = 209/248 (84.27%), Query Frame = -2
Query:   77 VEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANNPAQWKKXXXXXXXXXXXXESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHWTIVAKPRSF 820
            V+ERKKL STKS  NE LKCAIDHILDAQ KGEIN+DNVLYIVENINVAAIETTLWSIEWGIAELVNH EIQ KLR E+D VLGPGHQ+TEPD  KLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGG+D+PAESKILVNAWWLANNPA WKK            E+ VEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQSKIDT+EKGGQFSLHILKH TIVAKPR+F
Sbjct:  258 VDERKKLGSTKSTYNEGLKCAIDHILDAQKKGEINDDNVLYIVENINVAAIETTLWSIEWGIAELVNHQEIQNKLREEMDKVLGPGHQVTEPDLEKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPALWKKPEEFRPERFLEEEAHVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTSEKGGQFSLHILKHSTIVAKPRAF 505          
BLAST of CB294024 vs. ExPASy Swiss-Prot
Match: TCMO_SOYBN (Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1)

HSP 1 Score: 398.667 bits (1023), Expect = 2.088e-110
Identity = 201/249 (80.72%), Postives = 212/249 (85.14%), Query Frame = -2
Query:   77 VEERKKLASTKSMSNES-LKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANNPAQWKKXXXXXXXXXXXXESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHWTIVAKPRSF 820
            V+ERKKL STKS +N + LKCAIDHILDAQ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQ+KLR+E+D VLG GHQ+TEPD  KLPYLQAV+KETLRLRMAIPLLVPHMNLHDAKLGGYD+PAESKILVNAWWLANNPA WKK            ES VEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQS+IDT+EKGGQFSLHILKH TIVAKPRSF
Sbjct:  258 VDERKKLGSTKSTNNNNELKCAIDHILDAQRKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQQKLRDEIDRVLGAGHQVTEPDIQKLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAHWKKPEEFRPERFFEEESLVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSQIDTSEKGGQFSLHILKHSTIVAKPRSF 506          
BLAST of CB294024 vs. ExPASy Swiss-Prot
Match: TCMO_HELTU (Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 6.076e-110
Identity = 199/248 (80.24%), Postives = 208/248 (83.87%), Query Frame = -2
Query:   77 VEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANNPAQWKKXXXXXXXXXXXXESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHWTIVAKPRSF 820
            V+ERKK+ STK M N  LKCAIDHIL+A+ KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQ KLR+ELDT LGPG QITEPD   LPYLQAV+KETLRLRMAIPLLVPHMNLHDAKLGG+D+PAESKILVNAWWLANNP QWKK            E+KVEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQSKIDT EKGGQFSLHILKH TIVAKPRSF
Sbjct:  258 VDERKKIGSTKKMDNNQLKCAIDHILEAKEKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQAKLRHELDTKLGPGVQITEPDVQNLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPDQWKKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQSKIDTDEKGGQFSLHILKHSTIVAKPRSF 505          
BLAST of CB294024 vs. ExPASy Swiss-Prot
Match: TCMO_ZINEL (Trans-cinnamate 4-monooxygenase OS=Zinnia elegans GN=CYP73A12 PE=2 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 1.354e-109
Identity = 199/246 (80.89%), Postives = 206/246 (83.74%), Query Frame = -2
Query:   83 VEERKKLASTKSMSNESLKCAIDHILDAQTKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKLRNELDTVLGPGHQITEPDTHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDVPAESKILVNAWWLANNPAQWKKXXXXXXXXXXXXESKVEANGNDFRYLPFGVGRRSCPXXXXXXXXXXXXXGRLVQNFELLPPPGQSKIDTAEKGGQFSLHILKHWTIVAKPR 820
            V+ERKKL STKSM N  LKCAIDHILDA+ KGEINEDNVLYIVENINVAAIETTLWSIEW IAELVNHPEIQ KLR+EL + LGPG Q+TEPD HKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYD+PAESKILVNAWWLANNP QWKK            ESKVEANGNDFRYLPFGVGRRSCP             GRLVQNFELLPPPGQ K+DT EKGGQFSLHILKH TIVAKPR
Sbjct:  258 VDERKKLGSTKSMDNNQLKCAIDHILDAKDKGEINEDNVLYIVENINVAAIETTLWSIEWAIAELVNHPEIQAKLRHELVSQLGPGVQVTEPDLHKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPDQWKKPEEFRPERFLEEESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITIGRLVQNFELLPPPGQDKVDTTEKGGQFSLHILKHSTIVAKPR 503          
The following BLAST results are available for this feature:
BLAST of CB294024 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 341
Match NameE-valueIdentityDescription
TCMO_POPKI9.678e-11683.06Trans-cinnamate 4-monooxygenase OS=Populus kitakam... [more]
TCMO_POPTM3.678e-11583.06Trans-cinnamate 4-monooxygenase OS=Populus tremulo... [more]
TCMO_GLYEC2.636e-11382.26Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza ech... [more]
TCMO_CICAR7.177e-11180.65Trans-cinnamate 4-monooxygenase OS=Cicer arietinum... [more]
TCMO_CATRO7.177e-11181.05Trans-cinnamate 4-monooxygenase OS=Catharanthus ro... [more]
TCMO_PHAAU1.224e-11079.44Trans-cinnamate 4-monooxygenase OS=Phaseolus aureu... [more]
TCMO_PEA1.224e-11080.65Trans-cinnamate 4-monooxygenase OS=Pisum sativum G... [more]
TCMO_SOYBN2.088e-11080.72Trans-cinnamate 4-monooxygenase OS=Glycine max GN=... [more]
TCMO_HELTU6.076e-11080.24Trans-cinnamate 4-monooxygenase OS=Helianthus tube... [more]
TCMO_ZINEL1.354e-10980.89Trans-cinnamate 4-monooxygenase OS=Zinnia elegans ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_01aa07_b1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01aa07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB294024 ID=CB294024|Name=CB294024|organism=Citrus sinensis|type=EST|length=821bp
TGAACCGACTTAGAAAAAACCATTCAACCACTATGAAACAGTCTTAACAT
TACAACCAAATGGAATTGTGAAACTAGAATGATCTAGGCTTGGCAACAAT
GGTCCAGTGCTTCAAAATGTGCAAACTGAACTGCCCACCTTTCTCTGCAG
TGTCAATCTTAGATTGACCTGGAGGAGGCAAGAGCTCAAAGTTCTGTACC
AAACGCCCAATAGTGATACCAAGAATTGGCAAAGCAAGGATAATTCCAGG
GCAGCTTCTTCTTCCAACACCGAAAGGAAGGTAACGGAAGTCATTTCCAT
TAGCCTCAACCTTGGACTCCTCCTCCAAAAACCTCTCAGGCCTGAATTCT
TCAGGTTTCTTCCATTGGGCGGGATTGTTGGCGAGCCACCACGCGTTCAC
TAGGATTTTGCTCTCAGCAGGGACGTCGTAGCCTCCAAGCTTGGCGTCGT
GAAGGTTCATGTGCGGGACAAGAAGAGGAATTGCCATCCTAAGGCGAAGA
GTTTCCTTGATCACGGCCTGAAGGTAGGGTAGTTTGTGGGTGTCAGGCTC
AGTGATTTGATGACCAGGACCAAGCACGGTGTCAAGTTCATTGCGGAGCT
TCTTCTGGATTTCAGGATGATTCACTAGCTCTGCAATTCCCCACTCGATC
GACCAAAGAGTTGTCTCGATTGCGGCAACATTGATGTTCTCAACGATGTA
TAGAACGTTGTCCTCGTTGATTTCTCCCTTTGTCTGAGCGTCCAAAATAT
GATCGATTGCGCATTTCAAGCTTTCATTACTCATGCTCTTCGTGCTTGCC
AATTTCTTTCTCTCCTCAACA
back to top