CB304521

Overview
NameCB304521
Unique NameCB304521
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length459
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4200 contig Csv1_Contig4200:505..963. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304521 vs. ExPASy Swiss-Prot
Match: R10A3_ARATH (60S ribosomal protein L10a-3 OS=Arabidopsis thaliana GN=RPL10AC PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 9.382e-35
Identity = 72/76 (94.74%), Postives = 73/76 (96.05%), Query Frame = -2
Query:  231 ESLESKVNETKAPVKFQLKKVLCMGVAVGNLPMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 458
            ESLESKVNETKA VKFQLKKVLCMGVAVGNL MEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGP NR+F
Sbjct:  142 ESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPNRVF 217          
BLAST of CB304521 vs. ExPASy Swiss-Prot
Match: R10A1_ARATH (60S ribosomal protein L10a-1 OS=Arabidopsis thaliana GN=RPL10AA PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 3.565e-34
Identity = 72/76 (94.74%), Postives = 72/76 (94.74%), Query Frame = -2
Query:  231 ESLESKVNETKAPVKFQLKKVLCMGVAVGNLPMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 458
            ESLESKVNETKA VKFQLKKVLCMGVAVGNL MEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGP  RIF
Sbjct:  141 ESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPQRIF 216          
BLAST of CB304521 vs. ExPASy Swiss-Prot
Match: R10A2_ARATH (60S ribosomal protein L10a-2 OS=Arabidopsis thaliana GN=RPL10AB PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.355e-33
Identity = 70/76 (92.11%), Postives = 72/76 (94.74%), Query Frame = -2
Query:  231 ESLESKVNETKAPVKFQLKKVLCMGVAVGNLPMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 458
            ESLE+KVNETKA VKFQLKKVLCMGVAVGNL MEEKQ+FQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGP  RIF
Sbjct:  141 ESLEAKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQLFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPQRIF 216          
BLAST of CB304521 vs. ExPASy Swiss-Prot
Match: RL10A_CHLRE (60S ribosomal protein L10a OS=Chlamydomonas reinhardtii GN=RPL10A PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 9.108e-22
Identity = 49/76 (64.47%), Postives = 60/76 (78.95%), Query Frame = -2
Query:  231 ESLESKVNETKAPVKFQLKKVLCMGVAVGNLPMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 458
            ++LE  V +TK  +KFQLKKVLCMGVAV N+ M E +I  N+  ++NFLVSLLKKNWQNVRCLY+KSTMG   RI+
Sbjct:  138 KNLEEMVLDTKCSIKFQLKKVLCMGVAVANVGMTEGEIRTNIMYAINFLVSLLKKNWQNVRCLYIKSTMGKPIRIY 213          
BLAST of CB304521 vs. ExPASy Swiss-Prot
Match: RL10A_DANRE (60S ribosomal protein L10a OS=Danio rerio GN=rpl10a PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.554e-21
Identity = 45/76 (59.21%), Postives = 63/76 (82.89%), Query Frame = -2
Query:  231 ESLESKVNETKAPVKFQLKKVLCMGVAVGNLPMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 458
            E+L +KV+E K+ +KFQ+KKVLC+ VAVG++ M E+++  N+ ++VNFLVSLLKKNWQNVR LY+KSTMG   R++
Sbjct:  141 ENLGTKVDEVKSTIKFQMKKVLCLAVAVGHVKMSEEELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY 216          
BLAST of CB304521 vs. ExPASy Swiss-Prot
Match: RL10A_XENLA (60S ribosomal protein L10a OS=Xenopus laevis GN=rpl10a PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.650e-21
Identity = 44/76 (57.89%), Postives = 63/76 (82.89%), Query Frame = -2
Query:  231 ESLESKVNETKAPVKFQLKKVLCMGVAVGNLPMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 458
            E+L +KV+E K+ +KFQ+KKVLC+ VAVG++ + E+++  N+ +S+NFLVSLLKKNWQNVR LY+KSTMG   R++
Sbjct:  142 ENLVAKVDEVKSTIKFQMKKVLCLAVAVGHVKLTEEELVYNIHLSINFLVSLLKKNWQNVRALYIKSTMGKPQRLY 217          
BLAST of CB304521 vs. ExPASy Swiss-Prot
Match: RL10A_TRYBR (60S ribosomal protein L10a OS=Trypanosoma brucei rhodesiense GN=RPL10A PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 4.520e-21
Identity = 48/76 (63.16%), Postives = 60/76 (78.95%), Query Frame = -2
Query:  231 ESLESKVNETKAPVKFQLKKVLCMGVAVGNLPMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 458
            ESL  KV E ++ VKFQLKKVLC+G  VG++ M E Q+ QNV M++NFLVSLLKKNWQN++  Y+KSTMG S RI+
Sbjct:  139 ESLPDKVLELQSTVKFQLKKVLCLGTCVGHVDMTEDQVRQNVVMAINFLVSLLKKNWQNLKSAYIKSTMGKSQRIY 214          
BLAST of CB304521 vs. ExPASy Swiss-Prot
Match: RL10A_DICDI (60S ribosomal protein L10a OS=Dictyostelium discoideum GN=rpl10a PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 4.520e-21
Identity = 42/76 (55.26%), Postives = 63/76 (82.89%), Query Frame = -2
Query:  231 ESLESKVNETKAPVKFQLKKVLCMGVAVGNLPMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 458
            E + SK+N+ K+ VKFQLKKVLC+ VAVG++ + E+++  N+  S+NFLVSLLKK WQN++ LY+K++MGPS+R++
Sbjct:  142 EDMASKINDVKSTVKFQLKKVLCLAVAVGHIELTEREVATNIIQSINFLVSLLKKGWQNIKTLYVKTSMGPSHRVY 217          
BLAST of CB304521 vs. ExPASy Swiss-Prot
Match: RL10A_ICTPU (60S ribosomal protein L10a OS=Ictalurus punctatus GN=rpl10a PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 5.904e-21
Identity = 44/76 (57.89%), Postives = 62/76 (81.58%), Query Frame = -2
Query:  231 ESLESKVNETKAPVKFQLKKVLCMGVAVGNLPMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 458
            E+L +KV+E K+ +KFQ+KKVLC+ VAVG++ M E ++  N+ ++VNFLVSLLKKNWQNVR LY+KS+MG   R++
Sbjct:  141 ENLNTKVDEVKSTIKFQMKKVLCLAVAVGHVRMSEDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSSMGKPQRLY 216          
BLAST of CB304521 vs. ExPASy Swiss-Prot
Match: R10AB_DROME (60S ribosomal protein L10a-2 OS=Drosophila melanogaster GN=RpL10Ab PE=1 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 5.904e-21
Identity = 44/76 (57.89%), Postives = 62/76 (81.58%), Query Frame = -2
Query:  231 ESLESKVNETKAPVKFQLKKVLCMGVAVGNLPMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPSNRIF 458
            ES+  K+ E K+ +KFQ+KKVLC+ VAVG++ M+  ++ QNV +S+NFLVSLLKKNWQNVR L++KS+MGP  R++
Sbjct:  142 ESMIGKIEEVKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKKNWQNVRSLHVKSSMGPPQRLY 217          
The following BLAST results are available for this feature:
BLAST of CB304521 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
R10A3_ARATH9.382e-3594.7460S ribosomal protein L10a-3 OS=Arabidopsis thalia... [more]
R10A1_ARATH3.565e-3494.7460S ribosomal protein L10a-1 OS=Arabidopsis thalia... [more]
R10A2_ARATH1.355e-3392.1160S ribosomal protein L10a-2 OS=Arabidopsis thalia... [more]
RL10A_CHLRE9.108e-2264.4760S ribosomal protein L10a OS=Chlamydomonas reinha... [more]
RL10A_DANRE1.554e-2159.2160S ribosomal protein L10a OS=Danio rerio GN=rpl10... [more]
RL10A_XENLA2.650e-2157.8960S ribosomal protein L10a OS=Xenopus laevis GN=rp... [more]
RL10A_TRYBR4.520e-2163.1660S ribosomal protein L10a OS=Trypanosoma brucei r... [more]
RL10A_DICDI4.520e-2155.2660S ribosomal protein L10a OS=Dictyostelium discoi... [more]
RL10A_ICTPU5.904e-2157.8960S ribosomal protein L10a OS=Ictalurus punctatus ... [more]
R10AB_DROME5.904e-2157.8960S ribosomal protein L10a-2 OS=Drosophila melanog... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IVaR_A10 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IVaR_A10 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304521 ID=CB304521|Name=CB304521|organism=Citrus sinensis|type=EST|length=459bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTATTTCAATTCAACATCTCTCCA
ACAAAAAAATTCGTACAAGTCTACCATATTATAAGATTACTAGTGCATTA
AATTCAGAAAAGAAAAAGAAAAAGAAAAAGAAAATTGCAGGTTGGGACCA
TTCAAAGAAAGACATTTTGGGTATAATAAGATCACACTAGGTTTTCCCTA
CAAAACTCCAACATAAAGCAGAATTTCTTAAAAGATGCGGTTTGAAGGAC
CCATGGTACTCTTCAGATAGAGGCACCTGACATTCTGCCAGTTTTTCTTC
AACAATGAGACAAGGAAGTTAACACTCATTTGAACATTCTGGAAGATCTG
CTTCTCCTCCATTGGAAGGTTTCCAACAGCAACTCCCATGCAAAGCACCT
TCTTCAATTGGAACTTCACTGGTGCCTTAGTCTCGTTGACTTTGGACTCC
AGGGATTCT
back to top