CB304522

Overview
NameCB304522
Unique NameCB304522
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length349
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12567 contig Csv1_Contig12567:1045..1392. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304522 vs. ExPASy Swiss-Prot
Match: THI4_CITSI (Thiazole biosynthetic enzyme, chloroplastic OS=Citrus sinensis GN=THI1 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.388e-17
Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = -3
Query:  222 GPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL 347
            GPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL
Sbjct:  304 GPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL 345          
BLAST of CB304522 vs. ExPASy Swiss-Prot
Match: THI4_ALNGL (Thiazole biosynthetic enzyme, chloroplastic OS=Alnus glutinosa GN=THI4 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.616e-16
Identity = 38/42 (90.48%), Postives = 41/42 (97.62%), Query Frame = -3
Query:  222 GPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL 347
            GPTFGAMMISGQKAAHLALK+LG PNALDG+YVGG+HPELIL
Sbjct:  300 GPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIHPELIL 341          
BLAST of CB304522 vs. ExPASy Swiss-Prot
Match: THI4_ARATH (Thiazole biosynthetic enzyme, chloroplastic OS=Arabidopsis thaliana GN=THI1 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.138e-11
Identity = 32/42 (76.19%), Postives = 36/42 (85.71%), Query Frame = -3
Query:  222 GPTFGAMMISGQKAAHLALKSLGQPNALDGTYVGGVHPELIL 347
            GPTFGAMMISGQKA  LALK+LG PNA+DGT VG + PEL+L
Sbjct:  297 GPTFGAMMISGQKAGQLALKALGLPNAIDGTLVGNLSPELVL 338          
The following BLAST results are available for this feature:
BLAST of CB304522 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
THI4_CITSI1.388e-17100.00Thiazole biosynthetic enzyme, chloroplastic OS=Cit... [more]
THI4_ALNGL7.616e-1690.48Thiazole biosynthetic enzyme, chloroplastic OS=Aln... [more]
THI4_ARATH1.138e-1176.19Thiazole biosynthetic enzyme, chloroplastic OS=Ara... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IVaR_A11 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IVaR_A11 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304522 ID=CB304522|Name=CB304522|organism=Citrus sinensis|type=EST|length=349bp
TTTTTTTTTTTTTTTTTNNNTTTTTTTTTTAGACCGGAAACAAACACTTT
ATTCACAAAACCTCACAACATTATTTCATTATTCGCATCAACCATCCATC
ACAACCACCTAAATACAACTACTTTTTTGCCAGAGTTTATTTGCATGCAC
ACAGCTGATGAGTGATGATGCCTGTTATTACCAAATTAAGCATCAGCAGT
CTCAGCAGAATCAGCTGCAGCTAAGATCAGCTCAGGGTGAACGCCTCCCA
CATATGTACCGTCTAATGCATTCGGCTGGCCCAGTGACTTCAACGCCAAA
TGCGCAGCCTTCTGCCCCGATATCATCATTGCTCCAAATGTTGGCCCCC
back to top