CB304523

Overview
NameCB304523
Unique NameCB304523
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length613
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2673 contig Csv1_Contig2673:843..1455. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304523 vs. ExPASy Swiss-Prot
Match: CALM_SPIOL (Calmodulin OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 7.140e-34
Identity = 71/72 (98.61%), Postives = 72/72 (100.00%), Query Frame = -1
Query:  392 EDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 607
            +DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   78 KDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CB304523 vs. ExPASy Swiss-Prot
Match: CALM_MEDSA (Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 7.140e-34
Identity = 71/72 (98.61%), Postives = 72/72 (100.00%), Query Frame = -1
Query:  392 EDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 607
            +DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   78 KDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          

HSP 2 Score: 67.3958 bits (163), Expect = 6.503e-11
Identity = 34/74 (45.95%), Postives = 49/74 (66.22%), Query Frame = -1
Query:  392 DEDTDSE-EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 610
            D+ TD +  E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ EF+ +M  K
Sbjct:    3 DQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARK 76          
BLAST of CB304523 vs. ExPASy Swiss-Prot
Match: CALM_MALDO (Calmodulin OS=Malus domestica GN=CAM PE=3 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 7.140e-34
Identity = 71/72 (98.61%), Postives = 72/72 (100.00%), Query Frame = -1
Query:  392 EDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 607
            +DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   78 KDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CB304523 vs. ExPASy Swiss-Prot
Match: CALM_MAIZE (Calmodulin OS=Zea mays GN=CALM1 PE=2 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 7.140e-34
Identity = 71/72 (98.61%), Postives = 72/72 (100.00%), Query Frame = -1
Query:  392 EDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 607
            +DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   78 KDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CB304523 vs. ExPASy Swiss-Prot
Match: CALM_LILLO (Calmodulin OS=Lilium longiflorum PE=2 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 7.140e-34
Identity = 71/72 (98.61%), Postives = 72/72 (100.00%), Query Frame = -1
Query:  392 EDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 607
            +DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   78 KDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          

HSP 2 Score: 67.3958 bits (163), Expect = 6.503e-11
Identity = 34/74 (45.95%), Postives = 49/74 (66.22%), Query Frame = -1
Query:  392 DEDTDSE-EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 610
            D+ TD +  E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ EF+ +M  K
Sbjct:    3 DQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARK 76          
BLAST of CB304523 vs. ExPASy Swiss-Prot
Match: CALM_HORVU (Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 7.140e-34
Identity = 71/72 (98.61%), Postives = 72/72 (100.00%), Query Frame = -1
Query:  392 EDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 607
            +DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   78 KDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          

HSP 2 Score: 67.0106 bits (162), Expect = 8.493e-11
Identity = 34/74 (45.95%), Postives = 49/74 (66.22%), Query Frame = -1
Query:  392 DEDTDSE-EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 610
            D+ TD +  E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ EF+ +M  K
Sbjct:    3 DQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARK 76          
BLAST of CB304523 vs. ExPASy Swiss-Prot
Match: CALM_HELAN (Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3)

HSP 1 Score: 143.665 bits (361), Expect = 7.140e-34
Identity = 71/72 (98.61%), Postives = 72/72 (100.00%), Query Frame = -1
Query:  392 EDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 607
            +DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   78 KDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of CB304523 vs. ExPASy Swiss-Prot
Match: CALM_EUPCH (Calmodulin OS=Euphorbia characias PE=2 SV=4)

HSP 1 Score: 143.665 bits (361), Expect = 7.140e-34
Identity = 71/72 (98.61%), Postives = 72/72 (100.00%), Query Frame = -1
Query:  392 EDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 607
            +DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   78 KDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          

HSP 2 Score: 67.3958 bits (163), Expect = 6.503e-11
Identity = 34/74 (45.95%), Postives = 49/74 (66.22%), Query Frame = -1
Query:  392 DEDTDSE-EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 610
            D+ TD +  E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ EF+ +M  K
Sbjct:    3 DQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARK 76          
BLAST of CB304523 vs. ExPASy Swiss-Prot
Match: CALM_BRYDI (Calmodulin OS=Bryonia dioica PE=2 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 7.140e-34
Identity = 71/72 (98.61%), Postives = 72/72 (100.00%), Query Frame = -1
Query:  392 EDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 607
            +DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   78 KDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          

HSP 2 Score: 67.3958 bits (163), Expect = 6.503e-11
Identity = 34/74 (45.95%), Postives = 49/74 (66.22%), Query Frame = -1
Query:  392 DEDTDSE-EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 610
            D+ TD +  E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ EF+ +M  K
Sbjct:    3 DQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARK 76          
BLAST of CB304523 vs. ExPASy Swiss-Prot
Match: CALM7_ARATH (Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 7.140e-34
Identity = 71/72 (98.61%), Postives = 72/72 (100.00%), Query Frame = -1
Query:  392 EDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 607
            +DTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:   78 KDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          

HSP 2 Score: 67.3958 bits (163), Expect = 6.503e-11
Identity = 34/74 (45.95%), Postives = 49/74 (66.22%), Query Frame = -1
Query:  392 DEDTDSE-EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 610
            D+ TD +  E KEAF +FDKD +G I+  EL  VM +LG+  T+ E+ +MI E D DG+G I++ EF+ +M  K
Sbjct:    3 DQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARK 76          
The following BLAST results are available for this feature:
BLAST of CB304523 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 272
Match NameE-valueIdentityDescription
CALM_SPIOL7.140e-3498.61Calmodulin OS=Spinacia oleracea PE=1 SV=2[more]
CALM_MEDSA7.140e-3498.61Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2[more]
CALM_MALDO7.140e-3498.61Calmodulin OS=Malus domestica GN=CAM PE=3 SV=2[more]
CALM_MAIZE7.140e-3498.61Calmodulin OS=Zea mays GN=CALM1 PE=2 SV=2[more]
CALM_LILLO7.140e-3498.61Calmodulin OS=Lilium longiflorum PE=2 SV=2[more]
CALM_HORVU7.140e-3498.61Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2[more]
CALM_HELAN7.140e-3498.61Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3[more]
CALM_EUPCH7.140e-3498.61Calmodulin OS=Euphorbia characias PE=2 SV=4[more]
CALM_BRYDI7.140e-3498.61Calmodulin OS=Bryonia dioica PE=2 SV=2[more]
CALM7_ARATH7.140e-3498.61Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IVaR_A12 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IVaR_A12 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304523 ID=CB304523|Name=CB304523|organism=Citrus sinensis|type=EST|length=613bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTATAGGCCAAGAAACCTAAGC
TGATAGTCTGATACATAAAATAGGATACATATTTCGACCAAAAGAAAAAT
AAACATCGCAAGGGCAGAAATTAATGAAACACATTAAACAGACAACAACA
TTCATAGAACAGCAGAACAACTAAAATAATAAAAACCGAAAAGTTTTTCG
AGTCACAAGACATATTGACGAGGGAGACAACATTCTTCCTACACCATCAG
GCCCATCACCATTAAAAGACCATTGCTTCCTTTAGCCTGACCCTCATGAC
TATCAAATTAAAAATTGTAAAAGAGAAAACTAGGAATCCCTTTATAATTT
AGTCAACCCATTTTATAAGTATTGGTGGGTTGGGGTCATTACTTGGCCAT
CATAACCTTGACAAATTCCTCATAATTTATCTGGCCATCACCATCAACAT
CAGCTTCCCTTATCATCTCATCAACTTCTTCATCAGTAAGTTTCTCTCCT
AGGTTTGTCATCACATGGCGCAACTCAGCAGCTGAGATGAAACCATTCTG
ATCCTTGTCGAAAACCCGGAAGGCCTCTTTCAGCTCCTCCTCAGAGTCGG
TATCCTCATCTTC
back to top