CB304532

Overview
NameCB304532
Unique NameCB304532
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length372
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13788 contig Csv1_Contig13788:286..657. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304532 vs. ExPASy Swiss-Prot
Match: U520_DROME (Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster GN=CG5931 PE=2 SV=4)

HSP 1 Score: 137.887 bits (346), Expect = 1.534e-32
Identity = 61/118 (51.69%), Postives = 93/118 (78.81%), Query Frame = -3
Query:    2 KSIETVFDLVEMEDDERRELLQMSDVQLLDIARFCNRFPNIDMSFEVQDSENVRAGEDITLQVVLERDLEGRTEVGPVYSNRYPKAKEEGWWLVVGDTKTNQLLAIKRVSLQRKSRVK 355
            K IETVFD++E+ED++R  LLQ+SD+Q+ D+ARFCNR+PNI++++EV D + + +G  + + V LER+ E     GPV +  +P+ +EEGWW+V+GD KTN LL+IKR++LQ+K++VK
Sbjct: 1981 KKIETVFDIMELEDEDRTRLLQLSDLQMADVARFCNRYPNIELNYEVVDKDRINSGSTVNVVVQLEREDE---VTGPVIAPFFPQKREEGWWVVIGDPKTNSLLSIKRLTLQQKAKVK 2095          
BLAST of CB304532 vs. ExPASy Swiss-Prot
Match: U520_HUMAN (U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2)

HSP 1 Score: 137.502 bits (345), Expect = 2.004e-32
Identity = 60/118 (50.85%), Postives = 94/118 (79.66%), Query Frame = -3
Query:    2 KSIETVFDLVEMEDDERRELLQMSDVQLLDIARFCNRFPNIDMSFEVQDSENVRAGEDITLQVVLERDLEGRTEVGPVYSNRYPKAKEEGWWLVVGDTKTNQLLAIKRVSLQRKSRVK 355
            K +E+VFD++EMED+ER  LLQ++D Q+ D+ARFCNR+PNI++S+EV D +++R+G  + + V LER+ E     GPV +  +P+ +EEGWW+V+GD K+N L++IKR++LQ+K++VK
Sbjct: 1977 KGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEE---VTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVK 2091          
BLAST of CB304532 vs. ExPASy Swiss-Prot
Match: U520_CAEEL (Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Caenorhabditis elegans GN=Y46G5A.4 PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 8.438e-23
Identity = 51/119 (42.86%), Postives = 85/119 (71.43%), Query Frame = -3
Query:    2 KSIETVFDLVEMEDDERRELLQMSDVQLLDIARFCNRFPNIDMSFEVQDSENVRAGEDITLQVVLERDLEGRTEVGPVYSNRYP-KAKEEGWWLVVGDTKTNQLLAIKRVSLQRKSRVK 355
            K + +VF+L+E+E+D+R ++LQM   +L D+ARFCN +P+I+++ E+ +++ V + +++ L V LERD +      PV +  +P K KEEGWWLV+GD+++N LL IKR+ +  KS V+
Sbjct: 1976 KEVTSVFELLELENDDRSDILQMEGAELADVARFCNHYPSIEVATEL-ENDVVTSNDNLMLAVSLERDNDIDGLAPPVVAPLFPQKRKEEGWWLVIGDSESNALLTIKRLVINEKSSVQ 2093          
BLAST of CB304532 vs. ExPASy Swiss-Prot
Match: HELCL_DICDI (Activating signal cointegrator 1 complex subunit 3-like OS=Dictyostelium discoideum GN=ascc3l PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 2.714e-21
Identity = 50/127 (39.37%), Postives = 84/127 (66.14%), Query Frame = -3
Query:    2 KSIETVFDLVEMEDDERRELLQMSDVQLLDIARFCNRFPNIDMSFEVQDSENVRAGEDITLQVVLERDLEGRTEVGPVYSN---------RYPKAKEEGWWLVVGDTKTNQLLAIKRVSLQRKSRVK 355
            + IE+VFDL+ ++D+ R +LL +S  +  D+ +   ++P+ID+S++VQD +++ A   +T+++V+ERDL G  E  P+  N          YPK K  GWW ++GD+K N LLAIKR++  +K++VK
Sbjct: 2057 QGIESVFDLMSLDDNSRIQLLDLSQQESNDLVQSFMKYPDIDISYQVQDEDDLHADSIMTVEMVIERDL-GDDEENPIEINDSINVVSAPYYPKEKICGWWALIGDSKNNHLLAIKRITFLKKTKVK 2182          
BLAST of CB304532 vs. ExPASy Swiss-Prot
Match: BRR2_SCHPO (Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe GN=brr2 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 6.685e-20
Identity = 50/119 (42.02%), Postives = 74/119 (62.18%), Query Frame = -3
Query:    2 KSIETVFDLVEMEDDERRELLQMSDVQLLDIARFCNRFPNIDMSFEVQDSENVRAGEDITLQVVLERDLEGRTEVG-PVYSNRYPKAKEEGWWLVVGDTKTNQLLAIKRVSLQRKSRVK 355
            + +  VFD+++++D++R ELL M +  L   A F N++P+ID+ FE++DSE+V A     L V L R+LE   EV   V +  +P  K E WWLV+ D KT  LLAIK+++L R    K
Sbjct: 2013 EGVHDVFDIIDLDDEKRTELLHMDNAHLAKCAEFINKYPDIDIDFEIEDSEDVHANSPSVLIVQLTRELEEDEEVDTTVIAPYFPAQKTEHWWLVISDDKT--LLAIKKITLGRSLTTK 2129          
BLAST of CB304532 vs. ExPASy Swiss-Prot
Match: BRR2_YEAST (Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae GN=BRR2 PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 5.660e-19
Identity = 42/115 (36.52%), Postives = 78/115 (67.83%), Query Frame = -3
Query:    8 SIETVFDLVEMEDDERRELLQMSDVQLLDIARFCNRFPNIDMSFEVQDSENVRAGEDITLQVVLERDLEGRTEVGPVYSNRYPKAKEEGWWLVVGDTKTNQLLAIKRVSLQRKSR 352
            ++ETV+D++ +ED+ER E+L ++D QL  +A F N +PN+++++ + +S+++ +G    + + L RD+E   E   V S +YP  K E WWLV+G+    +L AIK+V+L ++++
Sbjct: 2012 NVETVYDIMALEDEERDEILTLTDSQLAQVAAFVNNYPNVELTYSLNNSDSLISGVKQKITIQLTRDVE--PENLQVTSEKYPFDKLESWWLVLGEVSKKELYAIKKVTLNKETQ 2124          
The following BLAST results are available for this feature:
BLAST of CB304532 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
U520_DROME1.534e-3251.69Putative U5 small nuclear ribonucleoprotein 200 kD... [more]
U520_HUMAN2.004e-3250.85U5 small nuclear ribonucleoprotein 200 kDa helicas... [more]
U520_CAEEL8.438e-2342.86Putative U5 small nuclear ribonucleoprotein 200 kD... [more]
HELCL_DICDI2.714e-2139.37Activating signal cointegrator 1 complex subunit 3... [more]
BRR2_SCHPO6.685e-2042.02Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyc... [more]
BRR2_YEAST5.660e-1936.52Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces c... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IVaR_C01 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IVaR_C01 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304532 ID=CB304532|Name=CB304532|organism=Citrus sinensis|type=EST|length=372bp
GCTTTACCCTGGACTTTCTTTGAAGAGACACCCTCTTGATGGCAAGCAAT
TGGTTAGTCTTCGTGTCACCTACAACAAGCCACCAGCCTTCCTCTTTGGC
TTTAGGATATCTGTTAGAATAGACAGGTCCCACCTCTGTTCTTCCTTCTA
GATCCCGCTCAAGAACCACCTGCAATGTAATGTCTTCCCCAGCCCTTACA
TTTTCACTGTCCTGCACCTCGAATGACATGTCAATGTTAGGGAAACGATT
GCAAAACCGAGCAATATCAAGTAACTGCACATCCGACATCTGCAAAAGCT
CACGCCTTTCATCATCTTCCATTTCCACCAAATCAAACACCGTCTCTATA
CTTTTTCCAGGGTTCTCTTGGC
back to top