CB304544

Overview
NameCB304544
Unique NameCB304544
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length411
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304544 vs. ExPASy Swiss-Prot
Match: AOC4_ARATH (Allene oxide cyclase 4, chloroplastic OS=Arabidopsis thaliana GN=AOC4 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 1.607e-29
Identity = 63/92 (68.48%), Postives = 73/92 (79.35%), Query Frame = -1
Query:  139 DYGHISVQGSYLTYKDTCLAVTGGSGIFEGVSGQVKLKQLVFPFKLFYTFYLKGI-KDLPGELMGKPVRPSPFVHPSPMGKACKPGAPVANF 411
            DYGHISVQG YLTY+DT LA+TGGSG+FEG  GQVKL+QLV+P KLFYTFYLKG+  DLP EL GK V PS  V P+   +A +PGA +ANF
Sbjct:  161 DYGHISVQGPYLTYEDTFLAITGGSGVFEGAYGQVKLRQLVYPTKLFYTFYLKGVAADLPVELTGKHVEPSKEVKPAAEAQATQPGATIANF 252          
BLAST of CB304544 vs. ExPASy Swiss-Prot
Match: AOC1_ARATH (Allene oxide cyclase 1, chloroplastic OS=Arabidopsis thaliana GN=AOC1 PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.579e-29
Identity = 62/92 (67.39%), Postives = 73/92 (79.35%), Query Frame = -1
Query:  139 DYGHISVQGSYLTYKDTCLAVTGGSGIFEGVSGQVKLKQLVFPFKLFYTFYLKGI-KDLPGELMGKPVRPSPFVHPSPMGKACKPGAPVANF 411
            DYGH+SVQG YLTY+D+ LA+TGG+GIFEG  GQVKL+QLV+P KLFYTFYLKG+  DLP EL+G PV PS  V P+P  KA KP   V+NF
Sbjct:  161 DYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQLVYPTKLFYTFYLKGLANDLPLELIGTPVPPSKDVEPAPEAKALKPSGVVSNF 252          
BLAST of CB304544 vs. ExPASy Swiss-Prot
Match: AOC3_ARATH (Allene oxide cyclase 3, chloroplastic OS=Arabidopsis thaliana GN=AOC3 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.360e-28
Identity = 62/92 (67.39%), Postives = 71/92 (77.17%), Query Frame = -1
Query:  139 DYGHISVQGSYLTYKDTCLAVTGGSGIFEGVSGQVKLKQLVFPFKLFYTFYLKGI-KDLPGELMGKPVRPSPFVHPSPMGKACKPGAPVANF 411
            DYGH+SVQG YLTY+DT LAVTGGSGIFEG  GQVKL+QLV+P KLFYTFYLKG+  DLP EL G  V PS  V P+P  KA +P   ++NF
Sbjct:  165 DYGHLSVQGQYLTYEDTFLAVTGGSGIFEGAYGQVKLRQLVYPTKLFYTFYLKGLANDLPLELTGTAVTPSKDVKPAPEAKAMEPSGVISNF 256          
BLAST of CB304544 vs. ExPASy Swiss-Prot
Match: AOC2_ARATH (Allene oxide cyclase 2, chloroplastic OS=Arabidopsis thaliana GN=AOC2 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 6.750e-28
Identity = 58/92 (63.04%), Postives = 72/92 (78.26%), Query Frame = -1
Query:  139 DYGHISVQGSYLTYKDTCLAVTGGSGIFEGVSGQVKLKQLVFPFKLFYTFYLKGI-KDLPGELMGKPVRPSPFVHPSPMGKACKPGAPVANF 411
            DYGH+SVQG YLTY+D+ LA+TGG+GIFEG  GQVKL+QLV+P KLFYTFYLKG+  DLP EL G PV PS  + P+P  KA +P   ++N+
Sbjct:  160 DYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQLVYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDIEPAPEAKALEPSGVISNY 251          
The following BLAST results are available for this feature:
BLAST of CB304544 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
AOC4_ARATH1.607e-2968.48Allene oxide cyclase 4, chloroplastic OS=Arabidops... [more]
AOC1_ARATH3.579e-2967.39Allene oxide cyclase 1, chloroplastic OS=Arabidops... [more]
AOC3_ARATH1.360e-2867.39Allene oxide cyclase 3, chloroplastic OS=Arabidops... [more]
AOC2_ARATH6.750e-2863.04Allene oxide cyclase 2, chloroplastic OS=Arabidops... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IVaR_D07 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IVaR_D07 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304544 ID=CB304544|Name=CB304544|organism=Citrus sinensis|type=EST|length=411bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCGTTTTTTTCCCATCCACTC
AAAATAAATAAAAATTAAAGGCATACGTATGCTTTCTTAATCATCACACG
CACTAATTAAATATTAATTGAAATCCTAGTTAATCAAAAAAATTAGCAAC
GGGGGCACCAGGCTTACAAGCCTTACCCATAGGGCTTGGGTGAACAAAAG
GGCTGGGCCTCACGGGCTTCCCCATAAGCTCTCCCGGCAGATCCTTAATG
CCCTTCAAATAAAAAGTATAAAACAGCTTAAATGGAAACACAAGTTGCTT
CAACTTAACCTGCCCACTCACTCCTTCAAAGATCCCTGACCCTCCAGTCA
CAGCGAGACACGTGTCCTTGTATGTCAAATAAGACCCCTGCACCGATATG
TGACCGTAGTC
back to top