CB304551

Overview
NameCB304551
Unique NameCB304551
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length621
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB304551_ssr159 microsatellite CB304551_ssr159:159..170. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig13803 contig Csv1_Contig13803:15..635. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304551 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDU (Non-specific lipid-transfer protein 1 OS=Prunus dulcis PE=3 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.537e-31
Identity = 59/97 (60.82%), Postives = 77/97 (79.38%), Query Frame = -1
Query:  223 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCFRVR 513
            P+  AITCGQV+++LAPCIP++R GG  PP  CC+G+R++N  ARTTPDRQAACNCLK+   ++ G+ PN AA LP +CGV IPY+ISPST+C  V+
Sbjct:   22 PIAQAITCGQVSSNLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANVK 117          
BLAST of CB304551 vs. ExPASy Swiss-Prot
Match: NLTP_MALDO (Non-specific lipid-transfer protein OS=Malus domestica GN=MALD3 PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.622e-31
Identity = 61/96 (63.54%), Postives = 76/96 (79.17%), Query Frame = -1
Query:  223 VTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCFRVR 510
            V +AITCGQVT+SLAPCI ++R+GG  PP  CC+G+R++NG ARTT DRQ ACNCLK   G+I G+ PN AAGLP +CGV +PYKIS ST+C  V+
Sbjct:   21 VAHAITCGQVTSSLAPCIGYVRSGGAVPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of CB304551 vs. ExPASy Swiss-Prot
Match: NLTP_HELAN (Non-specific lipid-transfer protein OS=Helianthus annuus PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 4.473e-31
Identity = 62/97 (63.92%), Postives = 74/97 (76.29%), Query Frame = -1
Query:  223 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCFRVR 513
            P T A++CGQV++SLAPCI +L  GG  PP  CCSGV+SLN AA+TTPDRQAAC CLK AY +I G+    AA  P +CGV IPYKISPSTDC +V+
Sbjct:   21 PYTEALSCGQVSSSLAPCISYLTKGGAVPPA-CCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKVQ 116          
BLAST of CB304551 vs. ExPASy Swiss-Prot
Match: LTP1_MORNI (Non-specific lipid-transfer protein 1 OS=Morus nigra PE=1 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 9.964e-31
Identity = 62/92 (67.39%), Postives = 75/92 (81.52%), Query Frame = -1
Query:  223 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCFRVR 498
            ITCGQV++SLAPCI +LR GG   P  CC+GVRSLN AA+TT DRQAACNCLK A+ +I+G+  N+AAGLP +CGV +PYKISPSTDC  V+
Sbjct:    1 ITCGQVSSSLAPCINYLRAGG-VVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91          
BLAST of CB304551 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUPE (Non-specific lipid-transfer protein 1 OS=Prunus persica PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.454e-29
Identity = 57/92 (61.96%), Postives = 73/92 (79.35%), Query Frame = -1
Query:  223 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCFRVR 498
            ITCGQV+++LAPCIP++R GG  PP  CC+G+R++N  ARTTPDRQAACNCLK+   ++ G+ PN AA LP +CGV IPYKIS ST+C  V+
Sbjct:    1 ITCGQVSSALAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK 91          
BLAST of CB304551 vs. ExPASy Swiss-Prot
Match: NLTP_PYRCO (Non-specific lipid-transfer protein OS=Pyrus communis PE=1 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 9.326e-29
Identity = 55/96 (57.29%), Postives = 74/96 (77.08%), Query Frame = -1
Query:  223 VTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCFRVR 510
            V +AITC QV+A+LAPCI ++R+GG  PP  CC+G++++NG A+TTPDRQAACNCLK   G++ G+ P  A  LP +CGV +PYKIS ST+C  V+
Sbjct:   21 VAHAITCSQVSANLAPCINYVRSGGAVPPA-CCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of CB304551 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUAR (Non-specific lipid-transfer protein 1 OS=Prunus armeniaca PE=1 SV=2)

HSP 1 Score: 126.331 bits (316), Expect = 1.218e-28
Identity = 57/92 (61.96%), Postives = 72/92 (78.26%), Query Frame = -1
Query:  223 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCFRVR 498
            ITCGQV++SLAPCI ++R GG  PP  CC+G+R++N  ARTTPDR+ ACNCLK+  G+I G+ PN AA LP +CGV IPYKIS ST+C  V+
Sbjct:    1 ITCGQVSSSLAPCIGYVRGGGAVPPA-CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK 91          
BLAST of CB304551 vs. ExPASy Swiss-Prot
Match: NLTP_PRUAV (Non-specific lipid-transfer protein OS=Prunus avium PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 4.629e-28
Identity = 53/97 (54.64%), Postives = 73/97 (75.26%), Query Frame = -1
Query:  223 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCFRVR 513
            P+  A+TCGQV+++LAPCI ++R GG  PP  CC+G+R++N  A+TT DRQ ACNCLK+   ++ G+  N AA LP +CGV +PYKISPST+C  V+
Sbjct:   22 PIAQALTCGQVSSNLAPCIAYVRGGGAVPPA-CCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117          
BLAST of CB304551 vs. ExPASy Swiss-Prot
Match: NLTP1_TOBAC (Non-specific lipid-transfer protein 1 OS=Nicotiana tabacum GN=LTP1 PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.000e-27
Identity = 60/97 (61.86%), Postives = 69/97 (71.13%), Query Frame = -1
Query:  223 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCFRVR 513
            P   AITCGQVT++LAPC+ +LR  G  P   CC GV++L  +ARTT DRQ AC CLK A G I GI    AAGLPS CGV IPYKISPSTDC +V+
Sbjct:   20 PCAEAITCGQVTSNLAPCLAYLRNTG--PLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ 114          
BLAST of CB304551 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDO (Non-specific lipid-transfer protein 1 OS=Prunus domestica PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.000e-27
Identity = 54/92 (58.70%), Postives = 72/92 (78.26%), Query Frame = -1
Query:  223 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCFRVR 498
            ITCGQV+++LAPCI +++ GG  PP  CC+G+R++N  ARTT DR+AACNCLK+  G+I G+ PN AA LP +CGV +PYKIS ST+C  V+
Sbjct:    1 ITCGQVSSNLAPCINYVKGGGAVPPA-CCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKCGVNVPYKISASTNCATVK 91          
The following BLAST results are available for this feature:
BLAST of CB304551 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
NLTP1_PRUDU1.537e-3160.82Non-specific lipid-transfer protein 1 OS=Prunus du... [more]
NLTP_MALDO2.622e-3163.54Non-specific lipid-transfer protein OS=Malus domes... [more]
NLTP_HELAN4.473e-3163.92Non-specific lipid-transfer protein OS=Helianthus ... [more]
LTP1_MORNI9.964e-3167.39Non-specific lipid-transfer protein 1 OS=Morus nig... [more]
NLTP1_PRUPE2.454e-2961.96Non-specific lipid-transfer protein 1 OS=Prunus pe... [more]
NLTP_PYRCO9.326e-2957.29Non-specific lipid-transfer protein OS=Pyrus commu... [more]
NLTP1_PRUAR1.218e-2861.96Non-specific lipid-transfer protein 1 OS=Prunus ar... [more]
NLTP_PRUAV4.629e-2854.64Non-specific lipid-transfer protein OS=Prunus aviu... [more]
NLTP1_TOBAC3.000e-2761.86Non-specific lipid-transfer protein 1 OS=Nicotiana... [more]
NLTP1_PRUDO3.000e-2758.70Non-specific lipid-transfer protein 1 OS=Prunus do... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IVaR_E02 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IVaR_E02 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304551 ID=CB304551|Name=CB304551|organism=Citrus sinensis|type=EST|length=621bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTGATCACTCAAAACACAGATCG
CGTTTACATATTTAATATGACATAAAAAGCAAATATACAAACATGACATG
AGAGTGAAACTCATACAAGTGGAGACTCGTTCGGACAAAGAAATTAACAT
AAATATTCTTTATTTATTTATTCTTCTCAGTCAATCATACTTGGAAAGTC
ACAGAGCTCAAACTCAACTTCACCTGACCCTAAAGCAGTCGGTGCTGGGG
CTGATCTTGTAAGGAATTCTGACTCCACATTGACTAGGAAGGCCAGCGGC
AACATTAGGTTTGATGCCGCGGATTGTTCCGTAAGCTCGTTTCAAGCAGT
TGCATGCAGCTTGGCGGTCAGGGGTGGTTCTGGCGGCGCCGTTGAGAGAC
CTGACGCCGCTACAGCATGGCGGTGGAGGAAAACGCCCTCCAGTTCTCAA
GAAAGGGATGCATGGAGCCAAGGAGGCTGTCACCTGCCCGCATGTTATGG
CATTAGTCACCGGGGCAGTCACCAGAATGCACAAAAGCAAAGCACAAACA
AGCTTAAGAGCAGCCATGAGGATTCTTCAGGGAGGCTTTTGCTTGGTTAT
AGCTAGTTATCAGGTTCTGTT
back to top