CB304558

Overview
NameCB304558
Unique NameCB304558
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length434
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11729 contig Csv1_Contig11729:581..1014. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304558 vs. ExPASy Swiss-Prot
Match: RS33_ARATH (40S ribosomal protein S3-3 OS=Arabidopsis thaliana GN=RPS3C PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 5.511e-23
Identity = 47/66 (71.21%), Postives = 55/66 (83.33%), Query Frame = -3
Query:  235 QPVNEYIDSAVRHVLLRQGVLGIKVKIMLSWDPNGKQGPTTPLPDLVTIHSPKDEEEYVKPTLVAT 432
            QP  EYID+AVRHVLLRQGVLG+KVKIML WDP GKQGP TPLPD+V IH+PK+++ Y+ P  V T
Sbjct:  162 QPTKEYIDAAVRHVLLRQGVLGLKVKIMLDWDPKGKQGPMTPLPDVVIIHTPKEDDVYIAPAQVVT 227          
BLAST of CB304558 vs. ExPASy Swiss-Prot
Match: RS31_ARATH (40S ribosomal protein S3-1 OS=Arabidopsis thaliana GN=RPS3A PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.039e-21
Identity = 47/68 (69.12%), Postives = 52/68 (76.47%), Query Frame = -3
Query:  229 QPVNEYIDSAVRHVLLRQGVLGIKVKIMLSWDPNGKQGPTTPLPDLVTIHSPKDEEEYVKPTLVATDI 432
            QP  EYID+AVRHVLLRQGVLGIKVKIML WDP GK GP TPLPD+V IH+PKD+  Y  P   A  +
Sbjct:  162 QPTKEYIDAAVRHVLLRQGVLGIKVKIMLDWDPTGKSGPKTPLPDVVIIHAPKDDVVYSAPAQAAAPV 229          
BLAST of CB304558 vs. ExPASy Swiss-Prot
Match: RS32_ARATH (40S ribosomal protein S3-2 OS=Arabidopsis thaliana GN=RPS3B PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.357e-21
Identity = 48/65 (73.85%), Postives = 51/65 (78.46%), Query Frame = -3
Query:  238 QPVNEYIDSAVRHVLLRQGVLGIKVKIMLSWDPNGKQGPTTPLPDLVTIHSPKDEEEYVKPTLVA 432
            QP  EYIDSAVRHVLLRQGVLGIKVK+ML WDP G  GP TPLPD+V IHSPK+EE    P  VA
Sbjct:  162 QPTKEYIDSAVRHVLLRQGVLGIKVKVMLDWDPKGISGPKTPLPDVVIIHSPKEEEAIYAPAQVA 226          
BLAST of CB304558 vs. ExPASy Swiss-Prot
Match: RS3_AMBME (40S ribosomal protein S3 OS=Ambystoma mexicanum GN=RPS3 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 5.338e-18
Identity = 42/54 (77.78%), Postives = 47/54 (87.04%), Query Frame = -3
Query:  268 PVNEYIDSAVRHVLLRQGVLGIKVKIMLSWDPNGKQGPTTPLPDLVTIHSPKDE 429
            PVN Y+D+AVRHVLLRQGVLGIKVKIML+WDP+GK GP  PLPD V+I  PKDE
Sbjct:  163 PVNYYVDTAVRHVLLRQGVLGIKVKIMLAWDPSGKIGPKKPLPDHVSIVEPKDE 216          
BLAST of CB304558 vs. ExPASy Swiss-Prot
Match: RS3_RAT (40S ribosomal protein S3 OS=Rattus norvegicus GN=Rps3 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 9.105e-18
Identity = 42/54 (77.78%), Postives = 46/54 (85.19%), Query Frame = -3
Query:  268 PVNEYIDSAVRHVLLRQGVLGIKVKIMLSWDPNGKQGPTTPLPDLVTIHSPKDE 429
            PVN Y+D+AVRHVLLRQGVLGIKVKIML WDP+GK GP  PLPD V+I  PKDE
Sbjct:  163 PVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKDE 216          
BLAST of CB304558 vs. ExPASy Swiss-Prot
Match: RS3_MOUSE (40S ribosomal protein S3 OS=Mus musculus GN=Rps3 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 9.105e-18
Identity = 42/54 (77.78%), Postives = 46/54 (85.19%), Query Frame = -3
Query:  268 PVNEYIDSAVRHVLLRQGVLGIKVKIMLSWDPNGKQGPTTPLPDLVTIHSPKDE 429
            PVN Y+D+AVRHVLLRQGVLGIKVKIML WDP+GK GP  PLPD V+I  PKDE
Sbjct:  163 PVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKDE 216          
BLAST of CB304558 vs. ExPASy Swiss-Prot
Match: RS32_XENLA (40S ribosomal protein S3-B OS=Xenopus laevis GN=rps3-B PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 9.105e-18
Identity = 42/54 (77.78%), Postives = 46/54 (85.19%), Query Frame = -3
Query:  268 PVNEYIDSAVRHVLLRQGVLGIKVKIMLSWDPNGKQGPTTPLPDLVTIHSPKDE 429
            PVN Y+D+AVRHVLLRQGVLGIKVKIML WDP+GK GP  PLPD V+I  PKDE
Sbjct:  163 PVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKDE 216          
BLAST of CB304558 vs. ExPASy Swiss-Prot
Match: RS31_XENLA (40S ribosomal protein S3-A OS=Xenopus laevis GN=rps3-A PE=2 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 9.105e-18
Identity = 42/54 (77.78%), Postives = 46/54 (85.19%), Query Frame = -3
Query:  268 PVNEYIDSAVRHVLLRQGVLGIKVKIMLSWDPNGKQGPTTPLPDLVTIHSPKDE 429
            PVN Y+D+AVRHVLLRQGVLGIKVKIML WDP+GK GP  PLPD V+I  PKDE
Sbjct:  163 PVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPSGKIGPKKPLPDHVSIVEPKDE 216          
BLAST of CB304558 vs. ExPASy Swiss-Prot
Match: RS3_PONAB (40S ribosomal protein S3 OS=Pongo abelii GN=RPS3 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.189e-17
Identity = 42/54 (77.78%), Postives = 45/54 (83.33%), Query Frame = -3
Query:  268 PVNEYIDSAVRHVLLRQGVLGIKVKIMLSWDPNGKQGPTTPLPDLVTIHSPKDE 429
            PVN Y+D+AVRHVLLRQGVLGIKVKIML WDP GK GP  PLPD V+I  PKDE
Sbjct:  163 PVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDE 216          
BLAST of CB304558 vs. ExPASy Swiss-Prot
Match: RS3_PIG (40S ribosomal protein S3 OS=Sus scrofa GN=RPS3 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.189e-17
Identity = 42/54 (77.78%), Postives = 45/54 (83.33%), Query Frame = -3
Query:  268 PVNEYIDSAVRHVLLRQGVLGIKVKIMLSWDPNGKQGPTTPLPDLVTIHSPKDE 429
            PVN Y+D+AVRHVLLRQGVLGIKVKIML WDP GK GP  PLPD V+I  PKDE
Sbjct:  163 PVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDE 216          
The following BLAST results are available for this feature:
BLAST of CB304558 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
RS33_ARATH5.511e-2371.2140S ribosomal protein S3-3 OS=Arabidopsis thaliana... [more]
RS31_ARATH1.039e-2169.1240S ribosomal protein S3-1 OS=Arabidopsis thaliana... [more]
RS32_ARATH1.357e-2173.8540S ribosomal protein S3-2 OS=Arabidopsis thaliana... [more]
RS3_AMBME5.338e-1877.7840S ribosomal protein S3 OS=Ambystoma mexicanum GN... [more]
RS3_RAT9.105e-1877.7840S ribosomal protein S3 OS=Rattus norvegicus GN=R... [more]
RS3_MOUSE9.105e-1877.7840S ribosomal protein S3 OS=Mus musculus GN=Rps3 P... [more]
RS32_XENLA9.105e-1877.7840S ribosomal protein S3-B OS=Xenopus laevis GN=rp... [more]
RS31_XENLA9.105e-1877.7840S ribosomal protein S3-A OS=Xenopus laevis GN=rp... [more]
RS3_PONAB1.189e-1777.7840S ribosomal protein S3 OS=Pongo abelii GN=RPS3 P... [more]
RS3_PIG1.189e-1777.7840S ribosomal protein S3 OS=Sus scrofa GN=RPS3 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IVaR_E09 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IVaR_E09 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304558 ID=CB304558|Name=CB304558|organism=Citrus sinensis|type=EST|length=434bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTGCAAGAAAATTGGTCGATAATT
ATGAAATCTTTAACAATACTGATGACTACAGTATATCAAAATTAACACCA
TGGAGTCTGAGGTATCCTTCATTAGCAACAAAAATGAAAACTAGAGCACT
TCAAATACCATTGATAAAATATCAAAGAAGATGAGACTATACCCCACTTC
GGCCTTAAGCCACTTGGATTGGGACCTCAATATCAGTAGCAACCAATGTT
GGCTTGACATACTCCTCTTCATCCTTGGGTGAGTGGATTGTTACGAGATC
AGGTAGAGGGGTAGTAGGACCTTGCTTTCCATTAGGATCCCAACTAAGCA
TGATCTTGACCTTAATACCAAGTACACCCTGTCTCAAAAGAACATGTCTC
ACAGCAGAGTCAATATATTCATTCACTGGCTGAC
back to top