CB304573

Overview
NameCB304573
Unique NameCB304573
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length637
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13761 contig Csv1_Contig13761:79..715. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304573 vs. ExPASy Swiss-Prot
Match: RS263_ARATH (40S ribosomal protein S26-3 OS=Arabidopsis thaliana GN=RPS26C PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.266e-36
Identity = 69/76 (90.79%), Postives = 72/76 (94.74%), Query Frame = -3
Query:  408 NGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 635
            NGGRNKH RGHVK IRCSNCGKCCPKDKAIKRF+VRNIVEQAA+RDVQEA VY+GYTLPKLYAK QYCVSCAIHSH
Sbjct:    7 NGGRNKHNRGHVKPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSH 82          
BLAST of CB304573 vs. ExPASy Swiss-Prot
Match: RS26_ORYSJ (40S ribosomal protein S26 OS=Oryza sativa subsp. japonica GN=RPS26 PE=2 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 3.685e-36
Identity = 66/76 (86.84%), Postives = 72/76 (94.74%), Query Frame = -3
Query:  408 NGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 635
            NGGRNKHGRGHVK+IRCSNC KCCPKDKAIKRF VRNIVEQAA+RDVQEACV+DGY LPKLYAK+ +CVSCAIH+H
Sbjct:    7 NGGRNKHGRGHVKYIRCSNCAKCCPKDKAIKRFQVRNIVEQAAIRDVQEACVHDGYVLPKLYAKVHHCVSCAIHAH 82          
BLAST of CB304573 vs. ExPASy Swiss-Prot
Match: RS262_ARATH (40S ribosomal protein S26-2 OS=Arabidopsis thaliana GN=RPS26B PE=2 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 4.812e-36
Identity = 68/76 (89.47%), Postives = 71/76 (93.42%), Query Frame = -3
Query:  408 NGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 635
            NGGRNKH RGHV  IRCSNCGKCCPKDKAIKRF+VRNIVEQAA+RDVQEA VY+GYTLPKLYAK QYCVSCAIHSH
Sbjct:    7 NGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSH 82          
BLAST of CB304573 vs. ExPASy Swiss-Prot
Match: RS261_ARATH (40S ribosomal protein S26-1 OS=Arabidopsis thaliana GN=RPS26A PE=2 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 4.812e-36
Identity = 68/76 (89.47%), Postives = 71/76 (93.42%), Query Frame = -3
Query:  408 NGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 635
            NGGRNKH RGHV  IRCSNCGKCCPKDKAIKRF+VRNIVEQAA+RDVQEA VY+GYTLPKLYAK QYCVSCAIHSH
Sbjct:    7 NGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLPKLYAKTQYCVSCAIHSH 82          
BLAST of CB304573 vs. ExPASy Swiss-Prot
Match: RS26_DROME (40S ribosomal protein S26 OS=Drosophila melanogaster GN=RpS26 PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.558e-29
Identity = 55/75 (73.33%), Postives = 65/75 (86.67%), Query Frame = -3
Query:  411 NGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 635
            NGGRNKH RGHVK +RC+NC +C PKDKAIK+F++RNIVE AAVRD+ EA ++D Y LPKLYAK+ YCVSCAIHS
Sbjct:    7 NGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLPKLYAKLHYCVSCAIHS 81          
BLAST of CB304573 vs. ExPASy Swiss-Prot
Match: RS26_ANOGA (40S ribosomal protein S26 OS=Anopheles gambiae GN=RpS26 PE=3 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 2.828e-28
Identity = 54/75 (72.00%), Postives = 63/75 (84.00%), Query Frame = -3
Query:  411 NGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 635
            NGGR KH RGHVK +RC+NC +C PKDKAIK+F++RNIVE AAVRD+ +A VY  Y LPKLYAK+ YCVSCAIHS
Sbjct:    7 NGGRCKHNRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISDASVYSSYVLPKLYAKLHYCVSCAIHS 81          
BLAST of CB304573 vs. ExPASy Swiss-Prot
Match: RS26B_SCHPO (40S ribosomal protein S26-B OS=Schizosaccharomyces pombe GN=rps26b PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 3.693e-28
Identity = 54/75 (72.00%), Postives = 63/75 (84.00%), Query Frame = -3
Query:  411 NGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 635
            N GRNKHGRGHVKF+RC NC +  PKDKAIKR+ +RN+VE AA+RD+ EA VY  YT+PKLY K+QYCVSCAIHS
Sbjct:    7 NNGRNKHGRGHVKFVRCINCSRAVPKDKAIKRWTIRNMVETAAIRDLSEASVYSEYTIPKLYIKLQYCVSCAIHS 81          
BLAST of CB304573 vs. ExPASy Swiss-Prot
Match: RS26_SCHCO (40S ribosomal protein S26 OS=Schizophyllum commune GN=RPS26 PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 4.823e-28
Identity = 54/76 (71.05%), Postives = 62/76 (81.58%), Query Frame = -3
Query:  408 NGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHSH 635
            NGGRNK GRGHV F+RCSNC +C  KDKAIKRF VRN+VE AA+RD+ +A VY  Y +PKLY K+ YCVSCAIHSH
Sbjct:    7 NGGRNKSGRGHVTFVRCSNCSRCVAKDKAIKRFTVRNMVESAAIRDISDASVYPEYAIPKLYIKIAYCVSCAIHSH 82          
BLAST of CB304573 vs. ExPASy Swiss-Prot
Match: RS26_OCTVU (40S ribosomal protein S26 OS=Octopus vulgaris GN=RPS26 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 6.300e-28
Identity = 54/75 (72.00%), Postives = 64/75 (85.33%), Query Frame = -3
Query:  411 NGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 635
            N GR K GRGHVK+IRC+NC +C PKDKAIK+F++RNIVE AAVRD+ +A VY+ Y LPKLYAK+ YCVSCAIHS
Sbjct:    7 NNGRGKKGRGHVKYIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISDASVYEVYALPKLYAKLLYCVSCAIHS 81          
BLAST of CB304573 vs. ExPASy Swiss-Prot
Match: RS26_CAEEL (40S ribosomal protein S26 OS=Caenorhabditis elegans GN=rps-26 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.833e-27
Identity = 53/75 (70.67%), Postives = 62/75 (82.67%), Query Frame = -3
Query:  411 NGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQEACVYDGYTLPKLYAKMQYCVSCAIHS 635
            N GRNK  RGHV FIRC+NCG+CCPKDKAIK+F+VRNIVE AAVRD+ +A  Y  Y LPKLY K+ YC++CAIHS
Sbjct:    7 NHGRNKKNRGHVAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYTQYALPKLYHKLHYCIACAIHS 81          
The following BLAST results are available for this feature:
BLAST of CB304573 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
RS263_ARATH1.266e-3690.7940S ribosomal protein S26-3 OS=Arabidopsis thalian... [more]
RS26_ORYSJ3.685e-3686.8440S ribosomal protein S26 OS=Oryza sativa subsp. j... [more]
RS262_ARATH4.812e-3689.4740S ribosomal protein S26-2 OS=Arabidopsis thalian... [more]
RS261_ARATH4.812e-3689.4740S ribosomal protein S26-1 OS=Arabidopsis thalian... [more]
RS26_DROME2.558e-2973.3340S ribosomal protein S26 OS=Drosophila melanogast... [more]
RS26_ANOGA2.828e-2872.0040S ribosomal protein S26 OS=Anopheles gambiae GN=... [more]
RS26B_SCHPO3.693e-2872.0040S ribosomal protein S26-B OS=Schizosaccharomyces... [more]
RS26_SCHCO4.823e-2871.0540S ribosomal protein S26 OS=Schizophyllum commune... [more]
RS26_OCTVU6.300e-2872.0040S ribosomal protein S26 OS=Octopus vulgaris GN=R... [more]
RS26_CAEEL1.833e-2770.6740S ribosomal protein S26 OS=Caenorhabditis elegan... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IVaR_G08 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IVaR_G08 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304573 ID=CB304573|Name=CB304573|organism=Citrus sinensis|type=EST|length=637bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTCGCAAAACAGAACAACAACAA
TTTTACTTCAATCACTCCATCAAAATTCTCTAGGGTTTTGATTCAAACTT
GCGACAGTAAACAGTTCTCCGATGCACGACAACAAAACACAAAACTAACA
TAAAAGTTTGCAGGGCTCTAATTAAACAGACCCACATATCTGATACCACC
ACATAAAAATCCCAAAAGCCTCAAAGGACCAAAAGCACCGACAGCAAAAA
GCTTTCAAGCACGAGCAGCAGCTGGAGCTCCAGCTGGACCACCAGCACGT
GGGCCTTGACCAAGAGCACCACCAGCCTTTGGCACATCATCCCTGCGCCT
GAAGCGTTGTGGGGGCTCACGGATCCTCCTGTTAGTACGGGAACGAACTC
TCACCACATGAGAGTGGATCGCACACGAGACGCAGTACTGCATCTTAGCA
TATAACTTAGGAAGAGTGTAACCGTCATAAACACACGCCTCCTGAACATC
CCTAACAGCAGCTTGCTCAACAATGTTCCTCACCAAAAACCTCTTAATCG
CCTTGTCCTTAGGGCAGCATTTGCCGCAGTTAGAGCAGCGGATGAACTTG
ACATGGCCACGGCCGTGCTTGTTCCTTCCTCCGTTCC
back to top