CB304576

Overview
NameCB304576
Unique NameCB304576
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length194
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5603 contig Csv1_Contig5603:18..211. BLAST: Citrus Unigene V1 Contigs to TAIR9
Homology
BLAST of CB304576 vs. ExPASy Swiss-Prot
Match: M030_ARATH (Uncharacterized mitochondrial protein AtMg00030 OS=Arabidopsis thaliana GN=AtMg00030 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.512e-22
Identity = 48/51 (94.12%), Postives = 48/51 (94.12%), Query Frame = 2
Query:   41 MFQFAKFEKSKERRLATELGYGFPIGDPWITDGISPWAFASESVLPSQWPG 193
            MFQFAKF KSKERRLATELGYGFPIGDPWITDGISPW FASESVLPSQ PG
Sbjct:    1 MFQFAKFSKSKERRLATELGYGFPIGDPWITDGISPWPFASESVLPSQCPG 51          
The following BLAST results are available for this feature:
BLAST of CB304576 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
M030_ARATH2.512e-2294.12Uncharacterized mitochondrial protein AtMg00030 OS... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IVaR_G11 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IVaR_G11 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304576 ID=CB304576|Name=CB304576|organism=Citrus sinensis|type=EST|length=194bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGGCTACTCAGATGTTTCAGT
TCGCTAAGTTTGAAAAGTCCAAAGAGCGCAGACTAGCCACGGAGCTTGGA
TACGGGTTCCCGATCGGAGATCCATGGATCACAGACGGGATCTCCCCATG
GGCTTTCGCCTCTGAAAGCGTCCTTCCTTCTCAATGGCCGGGCA
back to top