CB304633

Overview
NameCB304633
Unique NameCB304633
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length639
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304633 vs. ExPASy Swiss-Prot
Match: METB_ARATH (Cystathionine gamma-synthase, chloroplastic OS=Arabidopsis thaliana GN=CGS1 PE=2 SV=3)

HSP 1 Score: 132.109 bits (331), Expect = 2.337e-30
Identity = 62/70 (88.57%), Postives = 66/70 (94.29%), Query Frame = -3
Query:  428 FIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQALHAI 637
            F+D+LKIPYIAPSFGGCESIVDQPAIMSYWDL Q ERLKYGI DNLVRFSFGVEDFED+KAD+LQAL AI
Sbjct:  494 FVDSLKIPYIAPSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 563          
BLAST of CB304633 vs. ExPASy Swiss-Prot
Match: METB_HAEIN (Cystathionine gamma-synthase OS=Haemophilus influenzae GN=metB PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.068e-11
Identity = 31/66 (46.97%), Postives = 46/66 (69.70%), Query Frame = -3
Query:  440 FIDALKIPYIAPSFGGCESIVDQPAIMSYWDLSQSERLKYGIMDNLVRFSFGVEDFEDLKADVLQA 637
            F+ ++K+   A S GG ES +  PA  ++ D+ +SER+  GI + L+RFS G+ED ED+KAD+LQA
Sbjct:  299 FLKSIKLITFAESLGGTESFITYPATQTHMDIPESERVARGITNTLLRFSVGIEDVEDIKADLLQA 364          
The following BLAST results are available for this feature:
BLAST of CB304633 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
METB_ARATH2.337e-3088.57Cystathionine gamma-synthase, chloroplastic OS=Ara... [more]
METB_HAEIN7.068e-1146.97Cystathionine gamma-synthase OS=Haemophilus influe... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IaR_F11 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IaR_F11 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304633 ID=CB304633|Name=CB304633|organism=Citrus sinensis|type=EST|length=639bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCCGAATAGGTATATCAACGA
CTGTGGAAAACAATAAACTACAAAATGTCAATTTTCTTAATACATACTCT
TTAACAAAATTAATGAAATCCTACTAAATTTCCTTGTGCGTAAAATTAGT
CACCAAATTTAGTTGTATAATATTAAAAATGGATCGCAAGCCCCTCTTCT
CTACATTTTCGTTTCCTTCTGTTCTCTTCTCCACTCAATCATTCAGAAAC
TAGGTAACAAACTAAACAGAAAAGGAAGAACATTATAGATGAAGTTTTAA
GATTATTCAAGGATTATTGTCACTAAAACATAATAACAAAACGAACATAT
TCAAACATCAAAAGAGAATGCCGTTAGGAAAAGTAAAATGAAAATTTTGC
GAAGGTGAAACACAAAAAACACTTCTATATGGCATGCAGGGCCTGAAGTA
CATCTGCCTTCAAATCTTCAAAATCTTCCACTCCAAAGCTAAAGCGAACC
AAGTTATCCATAATCCCATACTTGAGCCTCTCCGATTGGCTAAGGTCCCA
ATACGACATTATAGCCGGCTGATCAACAATGCTCTCACAGCCACCGAAGG
ATGGAGCAATATATGGGATTTTCAAGGCATCAATAAATT
back to top