CB304639

Overview
NameCB304639
Unique NameCB304639
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length491
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304639 vs. ExPASy Swiss-Prot
Match: ZIP6_ARATH (Zinc transporter 6, chloroplastic OS=Arabidopsis thaliana GN=ZIP6 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 2.464e-29
Identity = 65/102 (63.73%), Postives = 76/102 (74.51%), Query Frame = -1
Query:  198 TVAYMCFMFSVTTPMGIVLGMIVFSVTGYDDSNPNALIMEXXXXXXXXXXXIYMGLVDLIAVDFFHNKLMS----SRSWLKKASFIALALGSTSMSILALWA 491
            TV YMC MF+VTTP+GIVLGM++F+ TGYDD NPNALIME           IYM LVDLIA+DFFHNK+++    S S LKK  F+AL LGS SMS+LALWA
Sbjct:  240 TVVYMCLMFAVTTPLGIVLGMVIFAATGYDDQNPNALIMEGLLGSFSSGILIYMALVDLIALDFFHNKMLTTCGESGSRLKKLCFVALVLGSASMSLLALWA 341          
BLAST of CB304639 vs. ExPASy Swiss-Prot
Match: ZIP5_ARATH (Zinc transporter 5 OS=Arabidopsis thaliana GN=ZIP5 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 3.233e-13
Identity = 43/98 (43.88%), Postives = 59/98 (60.20%), Query Frame = -1
Query:  198 TVAYMCFMFSVTTPMGIVLGMIVFSVTGYDDSNPNALIMEXXXXXXXXXXXIYMGLVDLIAVDFFHNKLMSSRSWLKKASFIALALGSTSMSILALWA 491
            ++  M   FSVTTP+GI +GM + S   YDDS+P ALI++           IYM LVD +A DF H K M S + L+  + I+L +G+  MS+LA WA
Sbjct:  266 SITIMSIFFSVTTPVGIAVGMAISS--SYDDSSPTALIVQGVLNAASAGILIYMSLVDFLAADFMHPK-MQSNTRLQIMAHISLLVGAGVMSLLAKWA 360          
BLAST of CB304639 vs. ExPASy Swiss-Prot
Match: ZIP3_ARATH (Zinc transporter 3 OS=Arabidopsis thaliana GN=ZIP3 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 4.223e-13
Identity = 44/98 (44.90%), Postives = 60/98 (61.22%), Query Frame = -1
Query:  198 TVAYMCFMFSVTTPMGIVLGMIVFSVTGYDDSNPNALIMEXXXXXXXXXXXIYMGLVDLIAVDFFHNKLMSSRSWLKKASFIALALGSTSMSILALWA 491
            +V  M   F++TTP+GIV+GM +     YD+S+P ALI++           IYM LVDL+A DF H K M S + L+  + IAL LG+  MS+LA WA
Sbjct:  245 SVTIMSTFFAITTPIGIVVGMGI--ANSYDESSPTALIVQGVLNAASAGILIYMSLVDLLAADFTHPK-MQSNTGLQIMAHIALLLGAGLMSLLAKWA 339          
BLAST of CB304639 vs. ExPASy Swiss-Prot
Match: ZIP1_ARATH (Zinc transporter 1 OS=Arabidopsis thaliana GN=ZIP1 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.096e-12
Identity = 39/94 (41.49%), Postives = 58/94 (61.70%), Query Frame = -1
Query:  198 MCFMFSVTTPMGIVLGMIVFSVTGYDDSNPNALIMEXXXXXXXXXXXIYMGLVDLIAVDFFHNKLMSSRSWLKKASFIALALGSTSMSILALWA 479
            M   FSVT P+GI +G+ + S  GY   +  A+++E           IYM LVDL+A DF + +L S+  WL  A++++L LG+ SMS+LA+WA
Sbjct:  263 MATFFSVTAPLGIGIGLGMSSGLGYRKESKEAIMVEGMLNAASAGILIYMSLVDLLATDFMNPRLQSN-LWLHLAAYLSLVLGAGSMSLLAIWA 355          
The following BLAST results are available for this feature:
BLAST of CB304639 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
ZIP6_ARATH2.464e-2963.73Zinc transporter 6, chloroplastic OS=Arabidopsis t... [more]
ZIP5_ARATH3.233e-1343.88Zinc transporter 5 OS=Arabidopsis thaliana GN=ZIP5... [more]
ZIP3_ARATH4.223e-1344.90Zinc transporter 3 OS=Arabidopsis thaliana GN=ZIP3... [more]
ZIP1_ARATH2.096e-1241.49Zinc transporter 1 OS=Arabidopsis thaliana GN=ZIP1... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IaR_G10 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IaR_G10 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304639 ID=CB304639|Name=CB304639|organism=Citrus sinensis|type=EST|length=491bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTATTAAGCTTTTCTATCAAATA
TTTATTGCCACCTCAATCATACACATTCTATATCATCATATCATATGTGC
AAAATGCAAAAACACATAACATTATTTTTCCCTTTTATCTCTTTTCTTCT
TTTTACTGCTTATTAATCTAATCAAACACAAGACTAAATTAATGTCAAGC
CCAAAGAGCAAGAATGGACATTGATGTAGAGCCAAGAGCTAGAGCAATGA
ATGAAGCTTTCTTCAACCAACTCCGAGAACTCATCAGCTTGTTGTGGAAA
AAATCAACAGCTATGAGATCCACAAGCCCCATGTATATAAGAATCCCTGA
AGACAAAGCACCCAGTAGCCCTTCCATTATCAAAGCGTTAGGGTTACTGT
CATCATAGCCCGTCACTGAAAACACTATCATCCCTAAAACTATCCCCATC
GGTGTTGTCACTGAAAACATGAAGCACATGTATGCCACTGT
back to top