CB304640

Overview
NameCB304640
Unique NameCB304640
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length576
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304640 vs. ExPASy Swiss-Prot
Match: ACA10_ARATH (Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2)

HSP 1 Score: 194.126 bits (492), Expect = 4.022e-49
Identity = 104/176 (59.09%), Postives = 122/176 (69.32%), Query Frame = -2
Query:   33 MEDNFKGSPYRRHTDEEAGCSQLGCDSDDEGTFSIPRTKDAPIVCFKRWRQAALVLNASRRFRYTLDLKKEEEKLQTLRKIRAHAQAIRAAVFFKEAGEQANGAEKLIAVP-SGDFAIGQEQLFIMTRDHNNNALQQFGRVKGLSDMLKTNLEKGIPGDDVDLLKRRSAFGSNTYP 557
            M   F  SP     D EAG S       ++  F I  TK+AP+   +RWRQAALVLNASRRFRYTLDLK+EE+K Q LRK+RAHAQAIRAA  FK A  +  G    +  P  GDF IGQEQ+  ++RD N  ALQ+ G V+GLSD+LKTNLEKGI GDD D+LKR+SAFGSNTYP
Sbjct:    1 MSGQFNNSPRGEDKDVEAGTSSF--TEYEDSPFDIASTKNAPVERLRRWRQAALVLNASRRFRYTLDLKREEDKKQMLRKMRAHAQAIRAAHLFKAAASRVTGIASPLPTPGGGDFGIGQEQIVSISRDQNIGALQELGGVRGLSDLLKTNLEKGIHGDDDDILKRKSAFGSNTYP 174          
BLAST of CB304640 vs. ExPASy Swiss-Prot
Match: ACA8_ARATH (Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 4.032e-41
Identity = 98/178 (55.06%), Postives = 127/178 (71.35%), Query Frame = -2
Query:   33 MEDNFKGSPYRRHT-DEEAGCSQLGCDSDDEGTFSIPRTKDAPIVCFKRWRQAALVLNASRRFRYTLDLKKEEEKLQTLRKIRAHAQAIRAAVFFKEAGEQANGAEKLI--AVPSGDFAIGQEQLFIMTRDHNNNALQQFGRVKGLSDMLKTNLEKGIPGDDVDLLKRRSAFGSNTYP 557
            M    K SP RR   D E+G S+   DSD + TF IP +K+A I   ++WR+AALVLNASRRFRYTLDLKKE+E  +  +KIR+HA A+ AA  F + G ++ G EK    A P+GDF I  EQL IM++DHN+ AL+Q+G  +GL+++LKTN EKGI GDD DLLKR++ +GSNTYP
Sbjct:    1 MTSLLKSSPGRRRGGDVESGKSE-HADSDSD-TFYIP-SKNASIERLQQWRKAALVLNASRRFRYTLDLKKEQETREMRQKIRSHAHALLAANRFMDMGRES-GVEKTTGPATPAGDFGITPEQLVIMSKDHNSGALEQYGGTQGLANLLKTNPEKGISGDDDDLLKRKTIYGSNTYP 174          
BLAST of CB304640 vs. ExPASy Swiss-Prot
Match: ACA9_ARATH (Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 2.704e-37
Identity = 88/172 (51.16%), Postives = 112/172 (65.12%), Query Frame = -2
Query:   33 RHTDEEAGCSQLGCDSDDE-------GTFSIPRTKDAPIVCFKRWRQAALVLNASRRFRYTLDLKKEEEKLQTLRKIRAHAQAIRAAVFFKEAGEQANG-AEKLIAVPSGDFAIGQEQLFIMTRDHNNNALQQFGRVKGLSDMLKTNLEKGIPGDDVDLLKRRSAFGSNTYP 524
            RH D EAG ++    SD E         F I  TK+A +   +RWRQAALVLNASRRFRYTLDL KEE      R IRAHAQ IRAA+ FK AGEQ         A  +G+F I  E+L  MTR+ N + LQQ+G VKG+++ LK+N+E+GI  D+ +++ R++AFGSNTYP
Sbjct:   17 RHDDMEAGSAKTEEHSDHEELQHDPDDPFDIDNTKNASVESLRRWRQAALVLNASRRFRYTLDLNKEEHYDNRRRMIRAHAQVIRAALLFKLAGEQQIAFGSSTPAASTGNFDIDLEKLVSMTRNQNMSNLQQYGGVKGVAEKLKSNMEQGINEDEKEVIDRKNAFGSNTYP 188          
The following BLAST results are available for this feature:
BLAST of CB304640 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
ACA10_ARATH4.022e-4959.09Calcium-transporting ATPase 10, plasma membrane-ty... [more]
ACA8_ARATH4.032e-4155.06Calcium-transporting ATPase 8, plasma membrane-typ... [more]
ACA9_ARATH2.704e-3751.16Calcium-transporting ATPase 9, plasma membrane-typ... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IaR_G11 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IaR_G11 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304640 ID=CB304640|Name=CB304640|organism=Citrus sinensis|type=EST|length=576bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCAAGGATATGTGTTTGATCC
AAATGCACTCCTCCGTTTCAGTAAGTCAACATCATCACCAGGAATCCCCT
TCTCTAAATTTGTTTTTAACATGTCCGATAGCCCTTTAACCCTGCCAAAC
TGCTGCAAAGCATTATTATTATGATCCCTTGTCATGATAAAAAGTTGTTC
TTGTCCAATTGCGAAATCACCACTGGGAACTGCAATTAATTTTTCAGCAC
CATTTGCTTGTTCCCCAGCTTCTTTAAAAAAAACGGCGGCTCGTATGGCT
TGTGCATGTGCTCTAATCTTCCTCAATGTTTGCAGCTTCTCTTCTTCTTT
CTTGAGGTCCAGTGTGTATCGAAATCGACGAGAAGCATTAAGCACTAGTG
CCGCTTGCCGCCAGCGTTTGAAACAAACGATAGGAGCATCCTTGGTTCTG
GGAATACTAAAAGTTCCCTCGTCGTCGGAATCGCAGCCAAGCTGGCTGCA
ACCGGCTTCTTCATCAGTATGTCGCCTATAAGGCGATCCCTTAAAATTGT
CTTCCATTGCTTGTTAAACTGTTCGC
back to top