CB304641

Overview
NameCB304641
Unique NameCB304641
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length643
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2940 contig Csv1_Contig2940:243..885. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304641 vs. ExPASy Swiss-Prot
Match: NAK_ARATH (Probable serine/threonine-protein kinase NAK OS=Arabidopsis thaliana GN=NAK PE=2 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 2.314e-17
Identity = 41/91 (45.05%), Postives = 64/91 (70.33%), Query Frame = -1
Query:  371 ELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKMLQIIDPRLENQYSVRAAQKACSLAYYRLSQNPKARPLMSDVVETLEPLQCANDGGNE 643
            ELL+GR+++DK +P  E +LVDWARP L +KR++L+++DPRL+ QYS+  A K   LA   +S + K+RP M+++V+T+E L    +   E
Sbjct:  272 ELLSGRRAIDKNQPVGEHNLVDWARPYLTNKRRLLRVMDPRLQGQYSLTRALKIAVLALDCISIDAKSRPTMNEIVKTMEELHIQKEASKE 362          
BLAST of CB304641 vs. ExPASy Swiss-Prot
Match: APK1B_ARATH (Protein kinase APK1B, chloroplastic OS=Arabidopsis thaliana GN=APK1B PE=2 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 6.732e-17
Identity = 44/89 (49.44%), Postives = 62/89 (69.66%), Query Frame = -1
Query:  377 ELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKMLQIIDPRLENQYSVRAAQKACSLAYYRLSQNPKARPLMSDVVETLEPLQCANDGG 643
            E+L+GR++VDK RP  EQ LV+WARP L +KRK+ ++ID RL++QYS+  A K  +LA   L+   K RP M++VV  LE +Q  N+ G
Sbjct:  273 EVLSGRRAVDKNRPPGEQKLVEWARPLLANKRKLFRVIDNRLQDQYSMEEACKVATLALRCLTFEIKLRPNMNEVVSHLEHIQTLNEAG 361          
BLAST of CB304641 vs. ExPASy Swiss-Prot
Match: APK1A_ARATH (Protein kinase APK1A, chloroplastic OS=Arabidopsis thaliana GN=APK1A PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.500e-16
Identity = 46/92 (50.00%), Postives = 65/92 (70.65%), Query Frame = -1
Query:  374 ELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKMLQIIDPRLENQYSVRAAQKACSLAYYRLSQNPKARPLMSDVVETLEPLQCAND--GGN 643
            ELL+GR++VDK RPS E++LV+WA+P L +KRK+ ++ID RL++QYS+  A K  +L+   L+   K RP MS+VV  LE +Q  N   GGN
Sbjct:  272 ELLSGRRAVDKNRPSGERNLVEWAKPYLVNKRKIFRVIDNRLQDQYSMEEACKVATLSLRCLTTEIKLRPNMSEVVSHLEHIQSLNAAIGGN 363          
BLAST of CB304641 vs. ExPASy Swiss-Prot
Match: Y3545_ARATH (Probable receptor-like protein kinase At3g55450 OS=Arabidopsis thaliana GN=At3g55450 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.558e-16
Identity = 43/83 (51.81%), Postives = 55/83 (66.27%), Query Frame = -1
Query:  395 ELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKMLQIIDPRLENQYSVRAAQKACSLAYYRLSQNPKARPLMSDVVETLEPLQ 643
            ELL GR+++D  RP+KEQ+LVDWARP L  +RK+L I+D RL +QY    A +  S+A   LS  PK+RP M  VV  L  LQ
Sbjct:  266 ELLCGRQALDHNRPAKEQNLVDWARPYLTSRRKVLLIVDTRLNSQYKPEGAVRLASIAVQCLSFEPKSRPTMDQVVRALVQLQ 348          
BLAST of CB304641 vs. ExPASy Swiss-Prot
Match: BIK1_ARATH (Serine/threonine-protein kinase BIK1 OS=Arabidopsis thaliana GN=BIK1 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.364e-16
Identity = 41/83 (49.40%), Postives = 57/83 (68.67%), Query Frame = -1
Query:  395 ELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKMLQIIDPRLENQYSVRAAQKACSLAYYRLSQNPKARPLMSDVVETLEPLQ 643
            E+L+G++++D  RP+KE++LVDWARP L  KRK+L I+D RL+ QY    A +  S+A   LS  PK+RP M  VV  L+ LQ
Sbjct:  271 EILSGKRALDHNRPAKEENLVDWARPYLTSKRKVLLIVDNRLDTQYLPEEAVRMASVAVQCLSFEPKSRPTMDQVVRALQQLQ 353          
BLAST of CB304641 vs. ExPASy Swiss-Prot
Match: APK2B_ARATH (Protein kinase 2B, chloroplastic OS=Arabidopsis thaliana GN=APK2B PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 7.443e-16
Identity = 43/88 (48.86%), Postives = 58/88 (65.91%), Query Frame = -1
Query:  380 ELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKMLQIIDPRLENQYSVRAAQKACSLAYYRLSQNPKARPLMSDVVETLEPLQCANDG 643
            ELL+GR++VDK++   EQSLVDWA P L DKRK+ +I+D RL  QY  + A  A SLA   L+ + K RP MS+V+  L+ L+    G
Sbjct:  285 ELLSGRRAVDKSKVGMEQSLVDWATPYLGDKRKLFRIMDTRLGGQYPQKGAYTAASLALQCLNPDAKLRPKMSEVLAKLDQLESTKPG 372          
BLAST of CB304641 vs. ExPASy Swiss-Prot
Match: RLCK7_ARATH (Probable serine/threonine-protein kinase RLCKVII OS=Arabidopsis thaliana GN=At1g07870 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.833e-14
Identity = 40/99 (40.40%), Postives = 60/99 (60.61%), Query Frame = -1
Query:  347 ELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKMLQIIDPRLENQYSVRAAQKACSLAYYRLSQNPKARPLMSDVVETLEPLQCANDGGNEISSSLTAN 643
            EL+TGRK++D T+  K+Q+LV WARP   D+R   +++DP L+ QY VR   +A +++   + + P  RP++SDVV  L  L  +    N  SSS   N
Sbjct:  299 ELITGRKAIDNTKTRKDQNLVGWARPLFKDRRNFPKMVDPLLQGQYPVRGLYQALAISAMCVQEQPTMRPVVSDVVLALNFLASSKYDPNSPSSSSGKN 397          
BLAST of CB304641 vs. ExPASy Swiss-Prot
Match: PBS1_ARATH (Serine/threonine-protein kinase PBS1 OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 6.967e-14
Identity = 36/82 (43.90%), Postives = 54/82 (65.85%), Query Frame = -1
Query:  398 ELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKMLQIIDPRLENQYSVRAAQKACSLAYYRLSQNPKARPLMSDVVETLEPL 643
            EL+TGRK++D   P  EQ+LV WARP  ND+RK +++ DPRL+ ++  RA  +A ++A   + +    RPL++DVV  L  L
Sbjct:  282 ELITGRKAIDSEMPHGEQNLVAWARPLFNDRRKFIKLADPRLKGRFPTRALYQALAVASMCIQEQAATRPLIADVVTALSYL 363          
BLAST of CB304641 vs. ExPASy Swiss-Prot
Match: APK2A_ARATH (Protein kinase 2A, chloroplastic OS=Arabidopsis thaliana GN=APK2A PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.552e-13
Identity = 39/91 (42.86%), Postives = 57/91 (62.64%), Query Frame = -1
Query:  371 ELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKMLQIIDPRLENQYSVRAAQKACSLAYYRLSQNPKARPLMSDVVETLEPLQCANDGGNE 643
            EL++GR+++D +    E SLVDWA P L DKRK+ +I+D +L  QY  + A  A +LA   L+ + K RP MS+V+ TLE L+     G +
Sbjct:  288 ELISGRRAMDNSNGGNEYSLVDWATPYLGDKRKLFRIMDTKLGGQYPQKGAFTAANLALQCLNPDAKLRPKMSEVLVTLEQLESVAKPGTK 378          
BLAST of CB304641 vs. ExPASy Swiss-Prot
Match: Y2197_ARATH (Probable protein kinase At2g41970 OS=Arabidopsis thaliana GN=At2g41970 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.993e-12
Identity = 40/94 (42.55%), Postives = 56/94 (59.57%), Query Frame = -1
Query:  362 ELLTGRKSVDKTRPSKEQSLVDWARPKLNDKRKMLQIIDPRLENQYSVRAAQKACSLAYYRLSQNPKARPLMSDVVETLEPLQCANDGGNEISS 643
            ELLTGRK VD T P  +QSLV WA P+L++  K+ Q IDP+L N +  +A  K  ++A   +      RP M+ VV+ L+PL  +   G E +S
Sbjct:  273 ELLTGRKPVDHTMPKGQQSLVTWATPRLSED-KVKQCIDPKLNNDFPPKAVAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNSKPAGPESTS 365          
The following BLAST results are available for this feature:
BLAST of CB304641 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
NAK_ARATH2.314e-1745.05Probable serine/threonine-protein kinase NAK OS=Ar... [more]
APK1B_ARATH6.732e-1749.44Protein kinase APK1B, chloroplastic OS=Arabidopsis... [more]
APK1A_ARATH1.500e-1650.00Protein kinase APK1A, chloroplastic OS=Arabidopsis... [more]
Y3545_ARATH2.558e-1651.81Probable receptor-like protein kinase At3g55450 OS... [more]
BIK1_ARATH4.364e-1649.40Serine/threonine-protein kinase BIK1 OS=Arabidopsi... [more]
APK2B_ARATH7.443e-1648.86Protein kinase 2B, chloroplastic OS=Arabidopsis th... [more]
RLCK7_ARATH1.833e-1440.40Probable serine/threonine-protein kinase RLCKVII O... [more]
PBS1_ARATH6.967e-1443.90Serine/threonine-protein kinase PBS1 OS=Arabidopsi... [more]
APK2A_ARATH1.552e-1342.86Protein kinase 2A, chloroplastic OS=Arabidopsis th... [more]
Y2197_ARATH4.993e-1242.55Probable protein kinase At2g41970 OS=Arabidopsis t... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IaR_G12 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IaR_G12 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304641 ID=CB304641|Name=CB304641|organism=Citrus sinensis|type=EST|length=643bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTATTAACAGTGGCTTCGGATC
AACATGATATTTTGTGCATTAAGTACAAAGCAAAAGCACCCATGATTTAA
CAAGAAAATTTGGTCATTCTGAAACGGGTCATAAGACGAAAACCACACAC
CCCACGAGTATACATATTTAGGTGACGTTTCTCATCTAACCCTGCATGCT
GCAGGGCCACCTGGGGAACAATTTGGATTAGGAGAACGACAACTAGAACC
AGGACCAACATTGTTGCTGAACCTTGGACGTGTTCGGTAACCTGGGATTC
CTCCCATTGCAAAAGCATTTGTAGCACCACCAGCAGCAACAACGAGATTT
GCAGTCAATGATGATGAGATTTCATTACCACCATCGTTAGCACATTGTAG
GGGTTCCAATGTTTCAACTACATCACTCATTAGAGGCCTTGCTTTAGGAT
TCTGGCTTAAACGATAGTATGCCAAGCTACAAGCTTTCTGTGCTGCCCTC
ACTGAGTACTGATTTTCCAATCTAGGGTCAATTATTTGCAGCATTTTTCT
CTTGTCATTTAGTTTTGGCCTGGCCCAATCTACCAAGCTTTGCTCTTTGC
TAGGTCTTGTCTTGTCAACAGACTTCCTTCCAGTCAATAGCTC
back to top