CB304643

Overview
NameCB304643
Unique NameCB304643
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length570
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12997 contig Csv1_Contig12997:15..587. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304643 vs. ExPASy Swiss-Prot
Match: SC61B_ARATH (Protein transport protein Sec61 subunit beta OS=Arabidopsis thaliana GN=At2g45070 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.609e-16
Identity = 40/44 (90.91%), Postives = 43/44 (97.73%), Query Frame = -3
Query:  251 TMLQFYTDDAPGLKISPNVVLVMSIGFITFVAVLHVMGKLYFVR 382
            +MLQFYTDDAPGLKISPNVVL+MSIGFI FVAVLHVMGKLYFV+
Sbjct:   39 SMLQFYTDDAPGLKISPNVVLIMSIGFIAFVAVLHVMGKLYFVK 82          
The following BLAST results are available for this feature:
BLAST of CB304643 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
SC61B_ARATH2.609e-1690.91Protein transport protein Sec61 subunit beta OS=Ar... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IaR_H04 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IaR_H04 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304643 ID=CB304643|Name=CB304643|organism=Citrus sinensis|type=EST|length=570bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCTGGCCAAATAGTAACA
TTTTCAATTAAAAAAAAAGATTGATATTTTGCAGTCTTTAAGGCATTGAA
TAAAAGTCATTCTCTCCAGAGTTACAACTACATTAAGCAACCTCAACCAC
CAGTAAACTGAACGAAAGCTAAATCTGGTTTTCAAAATCCAGACACATCA
TACCGAATTTAGATTTAGTATGCTATCAAATTCAGGCTGCTCTACTCTTT
TCGGACAAAGTAAAGCTTTCCCATGACATGAAGAACAGCAACAAAGGTAA
TGAATCCAATGCTCATGACAAGCACAACATTCGGAGAGATCTTAAGTCCT
GGAGCATCATCTGTGTAAAACTGGAGCATGGTACCAGCTGCACCTCCCGA
GGCCCCAGCCCCAGCCCCAGCCCCAGCACTGCTCGTCCTCCTCCTACGCA
TATTTGCAGTAGCTGCTGCGCTTCCTCTGGGGGGTGCAGGTCCGGTCAAA
GCCATTTTGACTCCACTCGAAAAATTTCAGATCGTCGAAGAAGCAGCAAT
TGCAAATTTTGATTCGTCCC
back to top